Recombinant Human Parathyroid hormone-related protein (PTHLH), partial

In Stock
Code CSB-EP018991HU
Abbreviation Recombinant Human PTHLH protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Signal Transduction
Alternative Names
HHM; MGC14611; Osteostatin; Parathyroid hormon like hormone isoform 2 preproprotein; Parathyroid hormone like hormone; Parathyroid hormone like hormone isoform 1 preproprotein; Parathyroid hormone like protein; Parathyroid hormone like related protein; Parathyroid hormone related protein; Parathyroid hormone-like protein; Parathyroid like protein; PLP; PTH related protein; PTH-rP; PTHLH; PTHR; PTHR_HUMAN; PTHrP; PTHrP[107-139]
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
37-175aa
Target Protein Sequence
AVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIRATSEVSPNSKPSPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLSDTSTTSLELDSR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
19.7kDa
Protein Length
partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Neuroendocrine peptide which is a critical regulator of cellular and organ growth, development, migration, differentiation and survival and of epithelial calcium ion transport. Regulates endochondral bone development and epithelial-mesenchymal interactions during the formation of the mammary glands and teeth. Required for skeletal homeostasis. Promotes mammary mesenchyme differentiation and bud outgrowth by modulating mesenchymal cell responsiveness to BMPs. Upregulates BMPR1A expression in the mammary mesenchyme and this increases the sensitivity of these cells to BMPs and allows them to respond to BMP4 in a paracrine and/or autocrine fashion. BMP4 signaling in the mesenchyme, in turn, triggers epithelial outgrowth and augments MSX2 expression, which causes the mammary mesenchyme to inhibit hair follicle formation within the nipple sheath. Promotes colon cancer cell migration and invasion in an integrin alpha-6/beta-1-dependent manner through activation of Rac1.; Osteostatin is a potent inhibitor of osteoclastic bone resorption.
Gene References into Functions
  1. In summary, these results reveal that PTHLH expression is a poor prognosis marker in head and neck squamous cell carcinoma patients, and RUNX2-PTHLH axis contributes to head and neck squamous cell carcinoma tumor growth. PMID: 28120940
  2. Our study thus demonstrates the dual roles of PTHrP on TGF-b1 signaling and FN up-regulation for the first time in glomerular mesangial cells . These data also provided new insights to guide development of therapy for diabetic kidney disease PMID: 28954822
  3. these data suggest that PTHrP(12-48) is a bioactive breast cancer-derived peptide that locally regulates the differentiation of hematopoietic cells and the activity of osteoclasts within the tumor-bone marrow microenvironment, perhaps to facilitate tumor control of bone. PMID: 28370412
  4. RSK activation via ERK modulates human colon cancer cells response to PTHrP. PMID: 28385776
  5. this is the first time that mutation recurrence has been detected in PTHLH associated with brachydactyly type E and we have observed that, as remarked before, this syndrome has high intrafamilial as well as interfamilial variability PMID: 28211986
  6. Antagonistic antibodies against the death receptors demonstrated that Apo2L/TRAIL mediated its apoptotic signals through activation of the TRAIL-R2 in PTHrP expressing breast cancer cells PMID: 23822995
  7. Amino PTHrP and carboxyl PTHrP can vary independently in different lung carcinomas. Carboxyl PTHrP may temper the stimulatory effect of amino PTHrP on cancer progression. PMID: 28342003
  8. PTHLH is a gastrin-regulated growth factor that might contribute to gastric epithelial cell homeostasis. PMID: 28408643
  9. Duplication of PTHLH co-segregates with osteochondroplasia with a combined brachydactyly type E/A1 in a three-generation pedigree. PMID: 26733284
  10. Data shown here expand the knowledge on the phenotypic presentation of PTHLH mutations, highlighting significant clinical variability and incomplete penetrance of the PTHLH-related symptoms. PMID: 26763883
  11. We showed that the supplementation of the osteogenic differentiation medium with PTHrP inhibited the alkaline phosphatase activity and the expression of the transcription factor DLX3, but the depletion of PTHrP did not support the differentiation of DFCs.We showed that SUFU (Suppressor Of Fused Homolog) was not regulated during the osteogenic differentiation in DFCs PMID: 27368119
  12. High expression of PTHRP is associated with Tongue squamous cell carcinoma. PMID: 27316348
  13. No relationship between plasma PTHrP levels and failure of tooth eruption, dental manifestations of pseudohypoparathyroidism or brachydactyly was found. PMID: 26855372
  14. we report three patients affected with brachydactyly type E, caused by PTHLH mutations expected to result in haploinsufficiency, and discuss our data compared to published reports. PMID: 26640227
  15. TGF-beta and PTHrP were confirmed to be involved in regulating the malignant progression in breast cancer, and PTHrP expression, to be associated with bone metastasis as a potential prognostic marker in ER negative breast cancer PMID: 26597083
  16. Data suggest affinity of ligands for binding site on PTH1R/parathyroid hormone 1 receptor, either in GTP-binding protein-dependent or -independent conformation, alters duration of action of ligand in target cells; ligands were peptide fragments of PTHRP. PMID: 26562265
  17. A novel heterozygous mutation in PTHLH gene was identified in a Chinese pedigree with brachydactyly type E. PMID: 25801215
  18. PTHLH/PTHrP could play a role in the pathogenesis of oral squamous cell carcinoma by affecting cell proliferation and cell cycle. PMID: 25539663
  19. PTHrP regulates Caco-2 cell proliferation via several signaling pathways. PMID: 25053227
  20. Intermittent application of PTHrP represents an important novel means to improve chondrogenesis of MSCs and may be considered as a supporting clinical-treatment mode for MSC-based cartilage defect regeneration PMID: 24836507
  21. Data show three individuals with duplications of the parathyroid hormone-like hormone (PTHLH) locus leading to a hitherto unrecognized syndrome characterized by acro-osteolysis, cortical irregularity of long bones and metadiaphyseal enchondromata. PMID: 25007883
  22. PTHrP positively modulates cell cycle progression and changes the expression of proteins involved in cell cycle regulation. PMID: 25051885
  23. miR-126-5p could directly target PTHrP and have a tumor suppressor function in giant cell tumor. PMID: 24973691
  24. High PTHLH expression is strongly associated with poor outcome both in overall survival and disease-free survival for patients who underwent standard nephrectomy. PMID: 24861371
  25. High PTHRP expression is associated with bone destruction in lung and breast cancer. PMID: 25359619
  26. Threonine at position 107 contributes to the osteogenic actions of PTHrP in osteoblasts. PMID: 24725082
  27. High PTHRP expression is associated with metastasis in breast cancer. PMID: 25368276
  28. PTHLH is important during embryonic development. [review] PMID: 25252304
  29. Data suggest that parathyroid hormone-related protein (PTHrP) may work through epithelial-to-mesenchymal transition (EMT) to promote an aggressive and metastatic phenotype in prostate cancer. PMID: 24465715
  30. PTHrP mediates energy wasting in fat tissues and contributes to the broader aspects of cancer cachexia; thus, neutralization of PTHrP might hold promise for ameliorating cancer cachexia and improving patient survival PMID: 25043053
  31. It is a critical physiological regulator of various biological processes, including bone and cartilage metabolism. (review) PMID: 24870837
  32. PTHrP was found to inhibit DKK1 expression through c-Jun-mediated inhibition of beta-catenin activity on the DKK1 promoter. PMID: 23752183
  33. Evaluation of clinical breast tumor samples revealed that reduced DLC1 expression was linked to elevated PTHLH expression and organ-specific metastasis to bone. PMID: 24590291
  34. High PTHRP mRNA expression correlated with lung cancer stage, presence of bone metastasis, and squamous cell carcinoma. PMID: 23810363
  35. PTHrP expression in human MDA-MB-231 breast cancer cells is critical for tumor growth and survival and osteoblast inhibition. PMID: 23983616
  36. PTHrP intracellular retention is down-regulated in osteo-differentiating cells whereas the secretion of the protein in the extracellular medium is up-regulated with respect to stem cells. PMID: 23810909
  37. these results evidence a protective effect of PTHrP under apoptotic conditions in intestinal cells. PMID: 23845990
  38. Data indicate that expressions of PTHrP, EPO, and VEGF were respectively related to advanced stage of clear cell renal cell carcinoma (ccRCC). PMID: 23780896
  39. Prostate cancer-derived PTHrP acts in the bone marrow to potentiate CD11b(+)Gr1(+) cells, which are recruited to tumor tissue where they contribute to tumor angiogenesis and growth. PMID: 24072746
  40. PTHrP excreted by giant cell tumor of bone stromal cells increases bone tumor cell local invasiveness and migration. PMID: 23466453
  41. new clues to understand the underlying mechanisms whereby PTHrP can increase bone formation. PMID: 23494914
  42. PTHrP is highly detectable in intermediate and epidermoid cells, and abundant expression of PTHrP in intermediate cells has a significant association with cancer malignancy. PMID: 23588777
  43. All 3 markers were studied independently and were associated with tumor percentage in metastatic lymph nodes. PVA had the strongest correlation, followed by PTHrP and then TACSTD1. PMID: 23625795
  44. Parathyroid hormone-related protein is induced by hypoxia and promotes expression of the differentiated phenotype of human articular chondrocytes. PMID: 23662774
  45. findings represent the initial genetic evidence that PTHrP regulates periosteal/intramembranous bone cell activity on cortical bone surfaces and indicate that PTHrP serves as a load-induced modeling tool in fibrous insertion sites during linear growth PMID: 23109045
  46. that miR-33a may be a potent tumor suppressor, which inhibits direct and indirect osteoclastogenesis through repression of PTHrP. PMID: 23458685
  47. PTHrP increases the promoter activity of the integrin alpha6 and beta4 subunits. PMID: 23499737
  48. Tristetraproline (TTP) is an RNA-binding protein that may be involved in ARE-mediated degradation of parathyroid hormone-related protein. PMID: 22960231
  49. activated PTHLH coupling feedback phosphoinositide to G-protein receptor signal-induced cell adhesion network in hepatocellular carcinoma PMID: 22997493
  50. systems theory analysis of PTHLH downstream leukocyte adhesion-mediated protein amino acid N-linked glycosylation coupling Notch and JAK-STAT cascade to iron-sulfur cluster assembly-induced aging network in no-tumor hepatitis/cirrhotic tissues PMID: 22955522

Show More

Hide All

Involvement in disease
Brachydactyly E2 (BDE2)
Subcellular Location
Cytoplasm. Nucleus. Secreted.
Protein Families
Parathyroid hormone family
Tissue Specificity
Ubiquitous. Also expressed in the mammary gland.
Database Links

HGNC: 9607

OMIM: 168470

KEGG: hsa:5744

STRING: 9606.ENSP00000379213

UniGene: Hs.591159

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*