Recombinant Human Peroxisome proliferator-activated receptor gamma coactivator 1-beta (PPARGC1B), partial

Code CSB-EP769812HU
Abbreviation Recombinant Human PPARGC1B protein, partial
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
PPARGC1B
Uniprot No.
Research Area
Others
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
868-1023aa
Target Protein Sequence
TRRNFRCESRGPCSDRTPSIRHARKRREKAIGEGRVVYIQNLSSDMSSRELKRRFEVFGEIEECEVLTRNRRGEKYGFITYRCSEHAALSLTKGAALRKRNEPSFQLSYGGLRHFCWPRYTDYDSNSEEALPASGKSKYEAMDFDSLLKEAQQSLH
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
25.6 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
13-23 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Plays a role of stimulator of transcription factors and nuclear receptors activities. Activates transcriptional activity of estrogen receptor alpha, nuclear respiratory factor 1 (NRF1) and glucocorticoid receptor in the presence of glucocorticoids. May play a role in constitutive non-adrenergic-mediated mitochondrial biogenesis as suggested by increased basal oxygen consumption and mitochondrial number when overexpressed. May be involved in fat oxidation and non-oxidative glucose metabolism and in the regulation of energy expenditure. Induces the expression of PERM1 in the skeletal muscle in an ESRRA-dependent manner.
Gene References into Functions
  1. the KAT4 promoter was significantly activated by the transcriptional factors, NFE2related factor 2 and peroxisome proliferatoractivated receptor coactivator 1beta, which are targets of Syvn1induced degradation PMID: 29916549
  2. Incrementally paced murine Pgc1beta(-/-) hearts show pro-arrhythmic atrial phenotypes that are age dependent. PMID: 28960529
  3. Insulin-like growth factor 1 receptor, associate of Myc 1, and peroxisome proliferator-activated receptor gamma coactivator 1beta are direct targets of miR-139 PMID: 26868851
  4. Study provides evidence that PGC1beta rs32579 was associated with nevus count, and both melanoma risk and mortality, which further emphasizes the critical role of PGC1s in multiple steps of melanocyte formation and melanoma development. PMID: 28542949
  5. The presence of the PPARGC1B (Ala203Pro) SNP did not modify the association between inorganic arsenic methylation capacity and breast cancer. PMID: 27557380
  6. Genetic variants of PPARGC1B are significantly associated with gout, and a missense single nucleotide polymorphism, rs45520937, augments NLRP3 and IL-1beta expression PMID: 28394398
  7. the forkhead box O3 (FOXO3)/liver kinase B1 (LKB1)/AMP-activated protein kinase/peroxisome proliferator-activated receptor-gamma co-activator-1beta (PGC-1beta)/pyruvate dehydrogenase-A1 pathway is essential for CD44 expression and cancer stem cells properties. PMID: 28507102
  8. We also suggest a novel hepatic protective role of PGC1B as a modulator of E2 effects on mitochondrial biogenesis PMID: 27885055
  9. we show an association of HER2-overexpression and PGC-1beta. PGC-1beta knockdown impairs HER2-overexpressing cells proliferation acting on ERRalpha signaling, metabolism, and redox balance. PMID: 26602383
  10. Further replication study confirmed the association signals of rs4705372 (P = 0.0026) and rs11743128 (P = 0.0387) in the independent validation sample. Our study results suggest that PPARGC1B is a novel susceptibility gene of Kashin-Beck disease . PMID: 27108113
  11. Human influenza hemagglutinin-tagged PPARGC1B coprecipitated more intensely with ERalpha in the +102525A than the +102525G construct after 17beta estradiol treatment PMID: 27027322
  12. Data suggest that PGC-1alpha and PGC-1beta could play a role in regulating retina cell survival, and may be therapeutic targets to prevent retinal degeneration. PMID: 26427438
  13. PGC-1(beta) and estrogen-related receptor alpha are aberrantly expressed in human colon cell lines and tumors. PMID: 26351140
  14. RUNX3 is related to both the severity of AS and the function of daily life. PPARGC1B is related to the function of daily life. PMID: 25494292
  15. Data show that PGC-1beta protein mediated the expression of proinflammatory cytokines and apoptosis through extracellular signal-regulated kinase (ERK), p38 and NF-kappaB in rheumatoid arthritis fibroblast-like synoviocytes. PMID: 25367151
  16. Variation in the PPARGC1B gene may be associated with type 2 diabetes among middle-aged Chinese men and women. PMID: 24359475
  17. cell apoptosis is orchestrated by the balance between several signaling pathways, and PGC-1beta takes part in these events in breast cancer cells mediated by the mTOR signaling pathway. PMID: 23877360
  18. PPARgamma and PPARGC1B polymorphisms modulate the association between phthalate exposure and BC risk PMID: 23866026
  19. DNA polymorphisms of PPARGC1B, coding a bona fide ER co-activator, are associated with ER-positive breast cancer risk. PMID: 21269472
  20. PGC-1b, a coactivator of both LXR-alpha and SREBP-1, was markedly down-regulated by OEPAs compared with EPA. PMID: 23680128
  21. PPARGC1B is associated with the susceptibility to ankylosing spondylitis in the Chinese Han population. PMID: 23637848
  22. PGC-1beta mediates adaptive chemoresistance to cisplatin associated with mitochondrial DNA mutations in non-small-cell lung cancer cells. PMID: 22777349
  23. Peroxisome proliferator-activated receptor gamma coactivator 1beta (PGC-1beta) protein attenuates vascular lesion formation by inhibition of chromatin loading of minichromosome maintenance complex in smooth muscle cells PMID: 23264620
  24. Inhibition of PGC-1a and PGC-1b blocks the alpha-MSH-mediated induction of MITF and melanogenic genes. PMID: 23201126
  25. Absence of PGC-1 proteins accelerated the transition to heart failure following pressure overload. PMID: 22939990
  26. Acetyl-L-carnitine activates the peroxisome proliferator-activated receptor-gamma coactivators PGC-1alpha/PGC-1beta-dependent signaling cascade of mitochondrial biogenesis and decreases the oxidized peroxiredoxins content in old rat liver PMID: 22533417
  27. Polymorphisms of -427C>T on the promoter and those of +102525G>A on exon 5 of the PPARGC1B gene may affect the development of AHR through the modulation of PPARGC1B gene products. PMID: 21692888
  28. Exercise can activate an upstream promoter in humans and support AMPK as a major regulator of transcripts from the canonical PGC-1alpha promoter and the involvement of beta-adrenergic stimulation in combination with AMPK in the regulation of PGC-1alpha-b. PMID: 21862727
  29. PGC-1beta is a potent regulator of angiogenesis, thus providing a novel link between the regulations of oxidative metabolism and vascular density. PMID: 21364124
  30. Data show that mitogen-activated protein kinase kinases direct mitochondrial biogenesis by selectively inducing PGC-1beta expression. PMID: 21458501
  31. physiological role of PGC-1beta: investigation of mitochondrial homeostasis regulatory pathway involving PGC-1beta and PI3K; investigation of regulation of PGC-1beta gene expression PMID: 21054343
  32. miR-378( *) inhibits the expression of two PGC-1beta partners, ERRgamma and GABPA, leading to a reduction in TCA cycle gene expression and oxygen consumption as well as an increase in lactate production and in cell proliferation PMID: 20889127
  33. Taken together, these results confirm the direct interaction of NRF-1 and ERR alpha with PGC-1 beta, and their participation in mitochondrial biogenesis and respiration. PMID: 20561910
  34. the PPARGC1B gene Ala203Pro polymorphism is associated with physical performance of athletes. PMID: 20058823
  35. The PGC-1-related protein PERC is a selective coactivator of estrogen receptor alpha PMID: 11854298
  36. role in coactivating the cardiac-enriched nuclear receptors estrogen-related receptor-alpha and -gamma PMID: 12181319
  37. role in activating orphan nuclear constitutive androstane receptor PMID: 12551939
  38. Variation of PGC-1beta may contribute to the pathogenesis of obesity, with a widespread Ala203 allele being a risk factor for the development of this common disorder. PMID: 15863669
  39. fatty acids differentially regulated expression of the genes encoding the PGC-1B isoform PMID: 16132959
  40. PPARGC1A, PPARGC1B, and EP300 may have roles for familial breast cancer susceptibility PMID: 16704985
  41. Acute elevation of plasma non-esterified fatty acd levels downregulates PPARGC1A, PPARGC1B and PPARA expression. PMID: 16896940
  42. Recent studies have elucidated the function of the PGC-1 coactivators in different tissues and have highlighted the implications of PGC-1 dysregulation in diseases such as diabetes, obesity, cardiomyopathy, or neurodegeneration. PMID: 17018837
  43. Upregulation of PGC-1alpha and PGC-1beta in the colorectal tumor cells can be part of an adaptation mechanism to help overcome the severe consequences of mtDNA mutations on oxidative phosphorylation. PMID: 17341490
  44. Study suggests that young carriers of a PGC-1beta 203Pro allele have enhanced insulin-stimulated glucose metabolism and may be protected against an age-related decline in PGC-1beta expression in muscle. PMID: 17579828
  45. training caused a decrease in PGC-1beta mRNA levels. PMID: 17690194
  46. A novel role of PGC-1beta in mitochondrial physiology, namely the control of mitochondrial fusion mainly through Mfn2. PMID: 18974884
  47. the association of the 482G/A polymorphism of the PGC-1alpha gene with type 2 diabetes and the quantitative and qualitative binding force changes between the PGC-1alpha domain mutant and MEF2C PMID: 19065516
  48. PGC-1alpha and PGC-1beta expression improved mitochondrial respiration in cells from patients with mitochondrial disorders. PMID: 19297390
  49. PGC-1beta is a substrate for general control of amino-acid synthesis (GCN5) and is acetylated on at least 10 lysine residues that are distributed along multiple domains of the protein. PMID: 19491097

Show More

Hide All

Subcellular Location
Nucleus.
Tissue Specificity
Ubiquitous with higher expression in heart, brain and skeletal muscle.
Database Links

HGNC: 30022

OMIM: 608886

KEGG: hsa:133522

STRING: 9606.ENSP00000312649

UniGene: Hs.483816

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*