Recombinant Human Phorbol-12-myristate-13-acetate-induced protein 1 (PMAIP1)

Code CSB-YP018229HU
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP018229HU
MSDS
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP018229HU-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP018229HU
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP018229HU
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
Uniprot No.
Alternative Names
Adult T cell leukemia derived PMA responsive; APR; APR_HUMAN; ATL-derived; Immediate early response protein APR; Immediate-early-response protein APR; NOXA; Phorbol 12 myristate 13 acetate induced protein 1; Phorbol-12-myristate-13-acetate-induced protein 1; PMA induced protein 1; PMA-induced protein 1; PMA-responsive gene; Pmaip1; Protein Noxa
Species
Homo sapiens (Human)
Expression Region
1-136
Target Protein Sequence
MPGKKARKNAQPSPARAPAGPAGTAGTARDQAGFAIGMQLRFTRGKKLLSSSLSSSPLAL PRGHEEQVQVAGSRVCYSTQEIWRQTELPAETSESDIQTLLLRNLTASKTCMRGLLQKSF LRRCTFHQFEERLHCN
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Promotes activation of caspases and apoptosis. Promotes mitochondrial membrane changes and efflux of apoptogenic proteins from the mitochondria. Contributes to p53/TP53-dependent apoptosis after radiation exposure. Promotes proteasomal degradation of MCL1. Competes with BAK1 for binding to MCL1 and can displace BAK1 from its binding site on MCL1. Competes with BIM/BCL2L11 for binding to MCL1 and can displace BIM/BCL2L11 from its binding site on MCL1.
Gene References into Functions
  1. Data report that NOXA is a physiological substrate of autophagy. Mechanistic studies revealed that NOXA is hijacked by p62 for degradation during the autophagic process, and the three lysine residues at the C-terminus of NOXA are required for its autophagic degradation. Furthermore, autophagy can block apoptosis by eliminating NOXA in both p53-dependent and p53-independent manners. PMID: 29758299
  2. Fluorizoline increased the protein levels of the pro-apoptotic B-cell lymphoma 2 family member NOXA in chronic lymphocytic leukemia cells. Furthermore, fluorizoline synergized with ibrutinib, 5-aminoimidazole-4-carboxamide riboside or venetoclax to induce apoptosis. PMID: 28619845
  3. By ubiquitylating and degrading NOXA through activating CRL5, UBE2F selectively promotes lung cancer cell survival and could, therefore, serve as a novel cancer target PMID: 27591266
  4. Data show that Noxa-mediated MCL-1 phosphorylation and degradation is regulated by CDK2. PMID: 27166195
  5. the c-FLIP and NOXA/Mcl-1 axis participated in the synergistic effect of pemetrexed plus cisplatin in human choroidal melanoma cells PMID: 28863158
  6. Noxa is involved in X-ray-induced lung injury. PMID: 27862899
  7. Arsenic trioxide induces Noxa-dependent apoptosis in rhabdomyosarcoma cells and acts synergistically with antimicrotubule drugs. PMID: 27521572
  8. knockdown of MCL-1 in MRT cell lines induced apoptosis and increased DOX sensitivity in malignant rhabdoid tumor cells PMID: 26680268
  9. high levels of miR21 expression may induce gastric cancer migration and invasion via the downregulation of Noxa expression PMID: 26847916
  10. Inhibition of SIRT1 could induce the Noxa expression in A549/DDP cells. PMID: 26903157
  11. Fluorizoline bind to prohibitin, inducing mitochondrial apoptotic pathway through NOXA and BIM upregulation. PMID: 26497683
  12. Noxa demethylation has a role in Bortezomib resistance in mantle cell lymphoma PMID: 25714012
  13. SATB1 as a Dual Regulator of Anti-Apoptotic BCL2 and Pro-Apoptotic NOXA Genes PMID: 26422397
  14. ALK-negative anaplastic large cell lymphoma is sensitive to bortezomib through Noxa upregulation and release of Bax from Bcl-2. PMID: 25975837
  15. BCL2 and BCLX phosphorylation represents a priming event in mitotic cell death that is triggered by NOXA-dependent MCL1 degradation. The MCL1 decay allows in turn BIM-dependent cell death. PMID: 25922916
  16. Overexpression of nonphosphorylatable Noxa resulted in enhanced mitochondria-mediated apoptosis in the infected epithelium. PMID: 25404713
  17. Results reveal that oncogenic activation of MEK/ERK drives Noxa expression to promote autophagy, and suggest that Noxa has an indirect anti-apoptosis role in melanoma cells under nutrient starvation conditions. PMID: 25365078
  18. Overall, these data reveal a Noxa-mediated signaling pathway that couples lysosomal membrane permeabilization with mitochondrial outer membrane permeabilization and ultimate apoptosis during oxidative stress. PMID: 23770082
  19. CDK5 activity provides resistance to heat-induced apoptosis through the expression of miR-23a and subsequent suppression of NOXA synthesis PMID: 25829494
  20. Mcl-1/Noxa axis is important to overcome resistance to mitochondrial apoptosis in squamous cell carcinoma. PMID: 25210795
  21. Cells overexpressing HSP70 had higher levels of miR-23a, maintained these levels after heat shock and accumulated lower levels of NOXA mRNA and protein. PMID: 25429623
  22. Noxa upregulation reduces the availability of Usp9x to Mcl-1, thereby promoting its ubiquitination and degradation, leading to the apoptosis of neoplastic cells. PMID: 24991768
  23. Overexpression of ApoL2 did not induce cell death on its own. ApoL2 did not sensitize or protect cells from overexpression of the BH3-only proteins Bmf or Noxa. PMID: 24901046
  24. Noxa recruits MCL-1 from the cytosol to the mitochondria modulating ABT-737 sensitivity in small cell lung cancer. PMID: 24525728
  25. these results suggest that the C-terminal tail of Noxa regulates the stability of both Noxa and Mcl-1. PMID: 24811167
  26. Mantle cell lymphoma are characterized by high constitutive NOXA gene expression but low levels of NOXA protein. PMID: 24457957
  27. Parthenolide triggers extrinsic apoptosis by up-regulating TNFRSF10B and intrinsic apoptosis through increasing the expression of PMAIP1. PMID: 24387758
  28. Knockdown of TRAIL and Noxa reduced FOXO3-induced apoptosis, implicating that mitochondrial destabilization amplifies TRAIL-signaling. PMID: 23828551
  29. Physalin A-induced apoptosis was triggered by activation of p53-Noxa pathway. PMID: 23684722
  30. CXCR4 chemokine receptor signaling induces apoptosis in acute myeloid leukemia cells via regulation of the Bcl-2 family members Bcl-XL, Noxa, and Bak. PMID: 23798675
  31. caspases contribute to trigger the mitochondrial apoptotic pathway by coupling Bcl-2/Bcl-xL inhibition to that of Mcl-1, via the pRb/E2F-1-dependent induction of Noxa PMID: 23429261
  32. Vorinostat, is able to ablate the multicellular resistance to bortezomib by its ability to restore expression of a key pro-apoptotic Bcl-2 family member, Noxa. PMID: 23300762
  33. NOXA, a sensor of proteasome integrity, is degraded by 26S proteasomes by an ubiquitin-independent pathway that is blocked by MCL-1. PMID: 22361683
  34. Noxa is a central determinant of hypersensitivity to cisplatin PMID: 23302226
  35. Oncolytic viruses selectively induced expression of TRAIL and Noxa in prostate cancer cells, lung cancer cells, and breast cancer cells downstream of RIG-I and MAVS. PMID: 23014529
  36. Novel but opposing roles for the p53 and TAp73 in the induction of Noxa and Bim and regulation of apoptosis. PMID: 22430213
  37. Our results suggested that polymorphisms of NOXA and MCL1 may modify the risk of HPV16-associated oropharyngeal cancer. PMID: 22548841
  38. detailed analysis of the Noxa promoter revealed that p73 and Sp1-like factors, Sp1 and KLF6, played key roles in the transcriptional control of this gene PMID: 22718761
  39. these data suggest a new mechanism by which NOXA chemosensitized ovarian cancer cells to cisplatin by inducing alterations in the Bax/Smac axis. PMID: 22590594
  40. show that miR-200c is a novel negative regulator of the pro-apoptotic Bcl-2 family member Noxa PMID: 22615771
  41. during skin hypoxia, promotes UVB-induced apoptosis in keratinocytes PMID: 22245094
  42. siRNA-mediated knockdown of Noxa resulted in cell cycle arrest following E2 treatment, indicating that Noxa expression is required for cell cycle progression in ER-positive breast cancer cells. PMID: 22216287
  43. these study suggested that the four mutations lowered the stability of the p53 DBD domain and induced aggregation of structurally destabilized p53, and thus disrupted the p53-PUMA/NOXA interaction. PMID: 22446329
  44. Multiple BH3 mimetics antagonize antiapoptotic MCL1 protein by inducing the endoplasmic reticulum stress response and up-regulating BH3-only protein NOXA. PMID: 21628457
  45. Bortezomib can enhance sensitivity of NB4 cells to apoptosis induced by As(2)O(3) which may be related to up-regulation of proapoptotic protein NOXA. PMID: 21518486
  46. Noxa is critical for sensitivity to cell death induced by 2-deoxyglucose. This is the first evidence of the implication of a BH3-only protein in death induced by 2-DG. PMID: 21911456
  47. Noxa triggers the degradation of Mcl-1 at the mitochondria according to the exclusive location of Noxa at this compartment. PMID: 21907705
  48. Noxa/Mcl-1 balance is regulated by glucose deprivation as well as by general metabolic stress PMID: 21516346
  49. A pathway leading from the detection of viral RNA during modified vaccinia virus infection by the cytosolic helicase-pathway, to the up-regulation of Noxa and apoptosis via IRF3 and type I IFN signalling. PMID: 21698224
  50. Noxa participates in triggering mitochondrial dysfunction in multiple apoptotic pathways through distinct mechanisms PMID: 21113147

Show More

Hide All

Subcellular Location
Mitochondrion.
Protein Families
PMAIP1 family
Tissue Specificity
Highly expressed in adult T-cell leukemia cell line.
Database Links

HGNC: 9108

OMIM: 604959

KEGG: hsa:5366

STRING: 9606.ENSP00000326119

UniGene: Hs.96

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1