Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

PLG

Uniprot No.

P00747

Research Area

Others

Alternative Names

Plasmin; Plasmin heavy chain A; Plasmin light chain B; Plasminogen; PLG; PLMN_HUMAN

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

274-560aa

Target Protein Sequence

QCLKGTGENYRGNVAVTVSGHTCQHWSAQTPHTHNRTPENFPCKNLDENYCRNPDGKRAPWCHTTNSQVRWEYCKIPSCDSSPVSTEQLAPTAPPELTPVVQDCYHGDGQSYRGTSSTTTTGKKCQSWSSMTPHRHQKTPENYPNAGLTMNYCRNPDADKGPWCFTTDPSVRWEYCNLKKCSGTEASVVAPPPVVLLPDVETPSEEDCMFGNGKGYRGKRATTVTGTPCQDWAAQEPHRHSIFTPETNPRAGLEKNYCRNPDGDVGGPWCYTTNPRKLYDYCDVPQC
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

36.0 kDa

Protein Length

Partial

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The formation of the recombinant plasmid by incorporating the gene encoding the Human PLG protein (274-560aa) into a plasmid vector initiates the generation of the recombinant Human PLG protein. Transforming the recombinant plasmid into e.coli cells and then selecting the positive e.coli cells based on their ability to survive in the presence of a specific antibiotic. The positive e.coli cells are cultured under conditions that stimulate the expression of the gene of interest. The protein is equipped with a N-terminal 6xHis tag. After expression, affinity purification is employed to isolate and purify the recombinant Human PLG protein from the cell lysate. Denaturing SDS-PAGE is utilized to resolve the resulting recombinant Human PLG protein, revealing a purity level exceeding 85%.

Target Background

Function

Plasmin dissolves the fibrin of blood clots and acts as a proteolytic factor in a variety of other processes including embryonic development, tissue remodeling, tumor invasion, and inflammation. In ovulation, weakens the walls of the Graafian follicle. It activates the urokinase-type plasminogen activator, collagenases and several complement zymogens, such as C1 and C5. Cleavage of fibronectin and laminin leads to cell detachment and apoptosis. Also cleaves fibrin, thrombospondin and von Willebrand factor. Its role in tissue remodeling and tumor invasion may be modulated by CSPG4. Binds to cells.; Angiostatin is an angiogenesis inhibitor that blocks neovascularization and growth of experimental primary and metastatic tumors in vivo.

Gene References into Functions

Apo(a) attenuates cell-surface plasmin-mediated conversion of Glu- to Lys-plasminogen. PMID: 29990619
Urinary angiostatin and VCAM-1 are predictive of specific histological changes in concurrent lupus nephritis renal biopsies. PMID: 29076253
We did not find an association of the AgP risk variant rs4252120 with CP. However, we identified a haplotype block downstream of PLG, which showed shared association with CP and AgP. PMID: 28548211
The homozygous alleles in F12 (rs1801020) and F13 (rs5985) was identified a genetic risk profile of thromboembolism in a Family. PMID: 27976734
Our findings that plasminogen and pSTAT3 are significantly associated with LI suggest that they may represent signaling nodes or biomarkers of pathways common to the processes of postlactational involution and LI. PMID: 28752190
A rare non-conservative missense mutation was newly identified in exon 9 of the PLG gene. PMID: 29548426
Plasminogen binds to the cell surface-exposed proteins of Candida parapsilosis. PMID: 28651026
plasmin cleaves surface-bound CCL21 to release the C-terminal peptide responsible for CCL21 binding to glycosaminoglycans on the extracellular matrix and cell surfaces, thereby generating the soluble form. PMID: 27301418
Analysis of plasminogen genetic variants in multiple sclerosis patients has been reported. PMID: 27194806
Enolase of Mtb is present on its surface and binds human plasminogen with high affinity. PMID: 27569900
The mechanism for plasminogen/M protein binding uncovered here may facilitate targeting of group A Streptococcus pyogenes virulence factors for disease management PMID: 28724633
t-PA binds to Lys91 in the MBP NH2-terminal region and PLG binds to Lys122 in the MBP COOH-terminal region. This proximity promotes the activation of PLG by t-PA. PMID: 28648598
in the presence of platelet polyphosphate and the downstream substrate fibrin, alphaFXIIa is a highly efficient and favorable plasminogen activator. PMID: 27694320
Plasmin(ogen) serves as a favorable biomarker for prediction of survival in advanced high-grade serous ovarian cancer PMID: 27935848
Our findings indicate a new pathway for bradykinin formation in patients with HAE, in which FXII is cleaved and activated by plasmin. PMID: 27130860
VWF susceptibility to plasmin proteolysis at K1491-R1492 is modulated by local N-linked glycan expression within A1A2A3, and specifically inhibited by heparin binding to the A1 domain. PMID: 28279966
bone morphogenetic proteins (BMPs) and mature BMPs that have been further cleaved by serum proteases induce cell cycle entry by dedifferentiating newt muscle cells. PMID: 28350991
Plasminogen and P4HA2 are involved in vascular remodelling and angiogenesis, suggesting a high relevance of these processes for the pathogenic mechanisms underlying this type of vasculitis PMID: 28041642
Plasminogen and OxPL-PLG were lower in patients presenting with an acute MI than in those with stable CAD and also in those with atherothrombotic MI (Type 1) vs. those with non-atherothrombotic MI (Type 2). PMID: 26510751
Although carriers with PLG:p.Ala620Thr show low plasminogen activity, this is not a predisposing variant for aHUS; and individuals of dysplasminogenemia are not at significantly increased risk of aHUS. PMID: 27194432
Five novel plasminogen gene mutations have been found in Turkish patients with type I plasminogen deficiency. PMID: 26340456
A novel plasminogen gene mutation, deficiency of plasminogen antigen and activity, and anti-plasminogen IgG and IgA antibodies were identified in a patient with adult-onset ligneous conjunctivitis. PMID: 25674820
S. aureus NCTC 8325-4 adheres to immobilized plasminogen in vitro and that the adhesion may be mediated by a C-terminal fragment of the PBP3 protein.[PBP3] PMID: 27488131
we demonstrated that PLG functions as a molecular bridge between tricellulin and streptococcal surface enolase (SEN). The wild type strain efficiently translocated across the epithelial monolayer, accompanied by cleavage of transmembrane junctional proteins. PMID: 26822058
Suggest that tubulointerstitial plasmin is associated with inflammation leading to renal fibrosis, and can cause the decline in renal function seen in patients with IgA nephropathy. PMID: 25971850
Plasminogen binding and activation by different glycolytic enzymes of M. pneumoniae play a role in successful colonization of the human respiratory tract. PMID: 26667841
reduced proteolytic activity of plasmin on structures of growing thrombi, rather than on complement activation fragments, explains the association of plasminogen deficiency with aHUS. PMID: 26637181
Zinc modulates fibrinolysis by attenuating tPA-mediated plasminogen activation and plasmin-induced fibrin degradation. PMID: 25789495
These results indicate that FXIIIa activity can be modulated by fibrinolytic enzymes, and suggest that changes in fibrinolytic activity may influence cross-linking of blood proteins. PMID: 26359437
Plasmin cleavage of iC3b provides a complement regulatory pathway that is as efficient as FI/CR1 but does not require a cellular cofactor. PMID: 25556624
PLG is the third replicated shared genetic risk factor of atherosclerosis and periodontitis. PMID: 25466412
Data show that preincubation with plasminogen, wild-type group A Streptococcus (GAS) NS88.2 degraded complement C3b. PMID: 23969887
whereas the presence of plasminogen did not affect the factor I cofactor activity of C4BP, the activation of plasminogen by urokinase-type plasminogen activator to active plasmin was significantly augmented in the presence of C4BP. PMID: 26067271
These studies demonstrate that GAS virulence can be explained by disparate hPg activation by SK2a and SK2b coupled with the coinherited M-proteins of these strains PMID: 26070561
PAM activated Plasminogen Glycoform II. PMID: 26029848
High plasma fibrinogen and low plasminogen are associated with poor survival in CTEPH patients without modern therapy. PMID: 24909805
Data show that different subpopulations of platelets harbor plasminogen by diverse mechanisms PMID: 25712989
manganese transport protein C (MntC) is an extracellular matrix- and plasminogen-binding protein PMID: 25409527
This review highlights the importance of the best-characterized components of the PLG/PLA cascade in the pathogenesis of cancer focusing on the role of the cell surface-PLG receptors (PLG-R). [review] PMID: 25407528
IGF-II, TGF-beta1 and VEGF-A and its receptor in malignant tumor tissue, as well as increasedplasmin release from proenzyme and MMP-3 activationis apparently associated with the formation of pathogenic mechanism of vasculature development PMID: 25993872
Angiostatin may play a role in the pathophysiology of preeclampsia. PMID: 24205998
The results suggested that EF-Tu and Eno serve as surface receptors for B. longum NCC2705 binding to human plasminogen. PMID: 24840471
Human plasmin activity loss results from the C-terminal lysine-dependent redistribution of enzyme molecules on a fibrin surface. PMID: 25222106
Genome-wide association analyses revealed common DNA variants in PLG, LPA, and near SIGLEC14 that contribute to plasma plasminogen level variation. PMID: 25208887
ANG interacts with plasminogen activation system at the leading edges of breast cancer cell surfaces and facilitates interactions of uPAR with uPA to regulate plasmin formation and cell migration. PMID: 24457100
Reduced plasminogen binding and delayed activation render gamma'-fibrin more resistant to lysis than gammaA-fibrin. PMID: 25128532
Binding of streptokinase Lys(414) to plasminogen kringle 4 plays a role in recognition of plasminogen by streptokinase. PMID: 25138220
The surface-displayed enolase, which serves as major pneumococcal plasminogen receptor, was identified as a key factor for plasminogen-mediated bacterial attachment in infection analyses with Streptococcus pneumoniae. PMID: 23906818
The results demonstrate that Bacteroides fragilis Bfp60 surface adhesin is responsible for the recognition of laminin and plasminogen-plasmin activation. PMID: 23850366
We propose that plasminogen activation on endothelial cells acts as a natural backup for ADAMTS13 to degrade obstructive platelet-VWF complexes. PMID: 24449821

Hide All

Involvement in disease

Plasminogen deficiency (PLGD)

Subcellular Location

Secreted. Note=Locates to the cell surface where it is proteolytically cleaved to produce the active plasmin. Interaction with HRG tethers it to the cell surface.

Protein Families

Peptidase S1 family, Plasminogen subfamily

Tissue Specificity

Present in plasma and many other extracellular fluids. It is synthesized in the liver.

Database Links

HGNC: 9071

OMIM: 173350

KEGG: hsa:5340

STRING: 9606.ENSP00000308938

UniGene: Hs.143436

Code	CSB-EP018188HU1
Abbreviation	Recombinant Human PLG protein, partial
MSDS	MSDS Datasheet
Size	$224
	Order now
Image	Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Plasminogen (PLG), partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage