Recombinant Human Platelet basic protein (PPBP), partial

Code CSB-EP018429HU1
Abbreviation Recombinant Human PPBP protein, partial
MSDS
Size $224
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Immunology
Alternative Names
B TG1; Beta TG ; Beta thromboglobulin; Beta-TG; C-X-C motif chemokine 7; Chemokine (C X C motif) ligand 7; Connective tissue activating peptide III; CTAP 3; CTAP III; CTAP-III; CTAP-III(1-81); CTAP3; CTAPIII; CXC chemokine ligand 7; CXCL 7; CXCL7; CXCL7_HUMAN; LA PF 4; LA-PF4; LDGF; Leukocyte derived growth factor; Leukocyte-derived growth factor; Low-affinity platelet factor IV; Macrophage-derived growth factor; MDGF; NAP 2; NAP-2; NAP-2(1-63); NAP-2(1-66); NAP-2(73); NAP-2(74); Neutrophil activating peptide 2; Neutrophil-activating peptide 2(1-63); PBP; Platelet basic protein; PPBP; Pro platelet basic protein (chemokine (C-X-C motif) ligand 7); Pro platelet basic protein; SCYB7; Small inducible cytokine subfamily B member 7; Small-inducible cytokine B7; TC1; TC2; TGB; TGB1; THBGB; THBGB1; Thrombocidin 1; Thrombocidin 2; Thromboglobulin; beta-1
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
59-125aa
Target Protein Sequence
AELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
34.4kDa
Protein Length
Partial
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
LA-PF4 stimulates DNA synthesis, mitosis, glycolysis, intracellular cAMP accumulation, prostaglandin E2 secretion, and synthesis of hyaluronic acid and sulfated glycosaminoglycan. It also stimulates the formation and secretion of plasminogen activator by human synovial cells. NAP-2 is a ligand for CXCR1 and CXCR2, and NAP-2, NAP-2(73), NAP-2(74), NAP-2(1-66), and most potent NAP-2(1-63) are chemoattractants and activators for neutrophils. TC-1 and TC-2 are antibacterial proteins, in vitro released from activated platelet alpha-granules. CTAP-III(1-81) is more potent than CTAP-III desensitize chemokine-induced neutrophil activation.
Gene References into Functions
  1. Low CXCL7 expression is associated with posterior longitudinal ligament ossification. PMID: 29782494
  2. In the prospective population-based Atherosclerosis Risk in Communities cohort, beta-thromboglobulin was not associated with cardiovascular disease risk. PMID: 28531882
  3. Cleavage of a factor Xa-specific chromogenic substrate was observed when Beta-TG was incubated with factor X, suggesting a direct interaction between Beta-TG and factor X. Beta-TG modulate coagulation in vitro via an interaction with factor X. PMID: 28384443
  4. This study demonstrated that platelet basic protein was detected in the serums of Alzheimer disease patients PMID: 27911324
  5. DEFA1, DEFA3, and PPBP expression was significantly increased in hyperlipidemia and coronary heart disease patients compared with controls. PMID: 28420383
  6. These results suggest that aberrant CXCL7 expression in peripheral blood cells is induced by renal cell carcinoma cells and may serve as a novel biomarker in the diagnosis of renal cell carcinoma . PMID: 28985012
  7. Two haplotype blocks, one upstream to the coding region of UGT2A1 (rs146712414, P = 9.1 x 10(-5); odds ratio [OR], 1.34; 95% confidence interval [CI], 1.16-1.56) and one downstream of the genes PF4/PPBP/CXCL5 (rs1595009, P = 1.3 x 10(-4); OR, 1.32; 95% CI, 1.15-1.52), were associated with AgP. PMID: 28467728
  8. NMR and modeling studies indicated that glycosaminoglycans (GAG) heparin binding to the heterodimer is distinctly different from the CXC chemokine ligand 7 (CXCL7) monomer. PMID: 28368308
  9. Cby's C-terminal domain alone binds to TC-1 with significantly greater affinity compared to full-length Cby, implying that target binding of the coiled-coil domain is affected by the flanking disordered regions. PMID: 27082063
  10. CXCL7 plays a promoting role in regulating the growth and metastasis of cholangiocarcinoma. PMID: 27959418
  11. Data suggest that neutrophil-activating peptide 2 (NAP-2) secreted by NK cells can bind to CXC Chemokine Receptor 2 (CXCR2) on mesenchymal stem cells (MSCs) leading to stimulation of its recruitment. PMID: 27052313
  12. Utilizing mass spectrometry-based proteomics, platelet basic protein has been identified as a candidate serum biomarker for transient ischemic attack PMID: 26307429
  13. Synovial Cxcl7 mRNA and protein were increased in early rheumatoid arthritis compared to uninflamed controls and resolving arthritis. PMID: 25858640
  14. Studied and characterized the dynamics and thermodynamic stability of monomer and homodimer structures of CXCL7. PMID: 26297927
  15. Leptin and neutrophil-activating peptide act synergistically to promote mesenchymal stem cell senescence through enhancement of the PI3K/Akt signaling pathway in systemic lupus erythematosus patients. PMID: 25989537
  16. CXCL7/CXCR2 signalling pathways are a predictive factor of poor outcome in metastatic colon cancer. PMID: 25580640
  17. CXCR4-CXCL12-CXCR7 regulates mTOR signaling in renal cancer cells. PMID: 24991762
  18. The antimicrobial thrombocidin peptides are found in human blood platelets, are deletion products of CXC chemokines and have antibacterial and antifungal activity. PMID: 10877842
  19. The level of beta-thromboglobulin was found significantly higher in female patients with rheumatoid arthritis. PMID: 23052484
  20. Testing of bacterial resistance to platelet antimicrobial lmw proteins (PMPs) may be advisable as a predictive indicator of susceptibility to treatment of infections such as infective endocarditis and other local infections of biofilm nature. PMID: 23619231
  21. beta-TG was evaluated for familial mediterranean fever cases and healthy controls, beta-TG levels were found significantly lower among patients; it is hypothesized that this difference may have resulted from the effect of colchicine use on platelet functions. PMID: 22939812
  22. Examined the prognostic values of SARS-associated proteome, and deciphered the identities of those with prognostic values.The associations of decreased serum PF4 and increased serum beta-TG levels with poor prognosis were confirmed by Western blot. PMID: 22740477
  23. modulates antimicrobial activity of phagocytes against L. pneumophila PMID: 22101183
  24. positive ratios of CXCR7, CXCL12 and CXCL11 in oral leukoplakia and oral squamous cell carcinoma tissues respectively, were significantly higher than that in normal epithelia PMID: 21442287
  25. Using microdialysis techniques we detected beta-TG release during an inflammatory response. We conclude that local platelet activation is induced by the heating stimulus. PMID: 20510637
  26. beta-TG is cleaved after being released from activated platelets, thereby becoming less mitogenic for fibroblasts PMID: 20224257
  27. CXCL7 promotes neutrophil adhesion to vascular endothelium and induces transendothelial migration. PMID: 12193731
  28. one or more high molecular weight protein is released from alpha-granules and is broken down into smaller fragments after release to form beta-thromboglobulin (beta-TG)-like proteins by the action of metal dependent proteases. PMID: 12297130
  29. Gene profiling iodentified PPBP from peripheral blood cells in coronary artery disease. PMID: 12878486
  30. Platelet basic protein is downregulated by glucocorticoids, and is defined as an immunosuppressive target of glucocorticoids. PMID: 14673015
  31. Our observations indicate that PBP and its derivates are constituents of the antimicrobial arsenal of human monocytes. Their increased expression after exposure to microorganisms allows a rapid host response to pathogens. PMID: 15316029
  32. activated human skin mast cells (MCs) convert CTAP-III into biologically active NAP-2 through proteolytic cleavage by released chymase. PMID: 16317101
  33. stromal-stimulated monocytes can serve as an additional source for CXCL7 peptides in the microenvironment and may contribute to the local regulation of megakaryocytopoiesis PMID: 16391012
  34. levels of BDNF and beta-TG in blood of Alzheimers patients is decreased; BDNF and beta-TG are associated with degree of platelet activation PMID: 16807663
  35. NAP-2 has the potential to induce inflammatory responses within the atherosclerotic plaque. By its ability to promote leukocyte and endothelial cell activation, such a NAP-2-driven inflammation could promote plaque rupture and acute coronary syndromes. PMID: 17045893
  36. CXCL7 decreased serum levels in advanced MDS, suggesting the possibility of a concerted disturbance of transcription or translation of these chemokines in advanced MDS PMID: 17220270
  37. delayed pressure urticaria may be associated with increased secretion of platelet chemokines PF4 and beta-TG, similar to that observed in cold urticaria PMID: 18632422
  38. stimulates the migration of mesenchymal stem cells in vitro PMID: 18707017

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Intercrine alpha (chemokine CxC) family
Database Links

HGNC: 9240

OMIM: 121010

KEGG: hsa:5473

STRING: 9606.ENSP00000296028

UniGene: Hs.2164

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*