Recombinant Human Pleckstrin homology-like domain family A member 2 (PHLDA2)

In Stock
Code CSB-EP687493HU
Abbreviation Recombinant Human PHLDA2 protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
PHLDA2
Uniprot No.
Research Area
Cell Biology
Alternative Names
Beckwith Wiedemann syndrome chromosome region 1 candidate protein C; Beckwith-Wiedemann syndrome chromosomal region 1 candidate gene C protein; BRW 1C; BRW1C; BWR 1C; BWR1C; HLDA 2; HLDA2; Imprinted in placenta and liver; Imprinted in placenta and liver protein; IPL; p17 Beckwith Wiedemann region 1C; p17 BWR1C; p17-Beckwith-Wiedemann region 1 C; p17-BWR1C; PHLA2_HUMAN; PHLDA 2; phlda2; Pleckstrin homology like domain family A member 2; Pleckstrin homology-like domain family A member 2; TSSC 3; Tumor suppressing STF cDNA 3 protein; Tumor suppressing subchromosomal transferable fragment candidate gene 3 protein; Tumor suppressing subchromosomal transferable fragment cDNA 3; Tumor suppressing subtransferable candidate 3; Tumor supressing STF cDNA 3; Tumor-suppressing STF cDNA 3 protein; Tumor-suppressing subchromosomal transferable fragment candidate gene 3 protein
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-152aa
Target Protein Sequence
MKSPDEVLREGELEKRSDSLFQLWKKKRGVLTSDRLSLFPASPRARPKELRFHSILKVDCVERTGKYVYFTIVTTDHKEIDFRCAGESCWNAAIALALIDFQNRRALQDFRSRQERTAPAAPAEDAVAAAAAAPSEPSEPSRPSPQPKPRTP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
44.1kDa
Protein Length
Full Length
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Plays a role in regulating placenta growth. May act via its PH domain that competes with other PH domain-containing proteins, thereby preventing their binding to membrane lipids.
Gene References into Functions
  1. PHLDA2 plays an important role in the occurrence and development of pregnancy complications by promoting trophoblast apoptosis and suppressing cell invasion. PMID: 26935516
  2. TSSC3 was a prognostic marker in osteosarcoma. PMID: 27044808
  3. TSSC3 downregulation promotes the Epithelial to mesenchymal transition (EMT) of osteosarcoma cells by regulating EMT markers via a signal transduction pathway that involves Snail, Wnt-beta-catenin/TCF, and GSK-3beta PMID: 26845447
  4. Placental PHLDA2 expression was significantly 2.3 fold higher in reduced fetal movements pregnancies resulting in delivery of a growth restricted compared with a normal birth weight infant. PMID: 26944942
  5. PHLDA2 may promote the occurrence/development of preeclampsia by inhibiting proliferation/migration/invasion of trophoblasts. PMID: 26218012
  6. The gene expression pattern of CDKN1C, H19, IGF2, KCNQ1 and PHLDA2 genes was evaluated using RT-PCR. PMID: 24986528
  7. elevated expression in placenta of growth restricted pregnancies [review] PMID: 24953163
  8. results suggest upregulated pleckstrin homology-like domain family A member 2 (PHLDA2) in placenta of monozygotic twins may be associated with the pathogenesis of singleton intrauterine growth restriction PMID: 24703004
  9. TSSC3 overexpression suppressed osteosarcoma cell growth and increased apoptosis through caspase-3 upregulation, suggesting that TSSC3 may play a pro-apoptosis role to maintain the normal balance of growth PMID: 24268429
  10. TSSC3 inhibits osteosarcoma tumorigenicity through reducing stemness and promoting apoptosis of tumor inducing cells PMID: 22610481
  11. A luciferase reporter assay was used to identify in the PHLDA2 promoter a 15 bp repeat sequence variant that significantly reduces PHLDA2-promoter efficiency. Maternal inheritance of the variant resulted in a significant increase in birth weight. PMID: 22444668
  12. The results suggest that placental PHLDA2 may provide a biomarker for suboptimal skeletal growth in pregnancies uncomplicated by overt fetal growth restriction. PMID: 22100507
  13. TSSC3 has a potent tumor suppressor role in osteosarcoma, probably by inhibition of growth and induction of apoptosis via the mitochondrial apoptosis pathway. PMID: 22021909
  14. PHLDA2 is a target gene of the BACH1 transcription factor according to ChIP-seq analysis in HEK 293 cells. PMID: 21555518
  15. Expression levels of PHLDA2 gene were upregulated in the first trimester pregnancy PMID: 20484977
  16. PHLDA2 gene is imprinted, with preferential expression from the maternal allele in placenta and liver. PMID: 9328465
  17. Transcripts of TSSC3 could not be detected in human oocytes and preimplantation embryos. PMID: 15952111
  18. Exposure of trophoblasts to hypoxia in vitro markedly reduced the expression of PHLDA2. PMID: 16584773
  19. association with low birth weight PMID: 17180344
  20. Up-regulation of TSSC3 occurred in Dicer knockdown cells. PMID: 17303335

Show More

Hide All

Subcellular Location
Cytoplasm. Membrane; Peripheral membrane protein.
Protein Families
PHLDA2 family
Tissue Specificity
Expressed in placenta and adult prostate gland. In placenta, it is present in all cells of the villous cytotrophoblast. The protein is absent in cells from hydatidiform moles. Hydatidiform mole is a gestation characterized by abnormal development of both
Database Links

HGNC: 12385

OMIM: 602131

KEGG: hsa:7262

STRING: 9606.ENSP00000319231

UniGene: Hs.154036

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*