Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

PLXNA1

Uniprot No.

Q9UIW2

Research Area

Neuroscience

Alternative Names

PLXNA1; NOV; PLXN1; Plexin-A1; Semaphorin receptor NOV

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

986-1152aa

Target Protein Sequence

LNAGSDVAVSVGGRPCSFSWRNSREIRCLTPPGQSPGSAPIIININRAQLTNPEVKYNYTEDPTILRIDPEWSINSGGTLLTVTGTNLATVREPRIRAKYGGIERENGCLVYNDTTMVCRAPSVANPVRSPPELGERPDELGFVMDNVRSLLVLNSTSFLYYPDPVL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

22.3kDa

Protein Length

Partial

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Expressing the recombinant Human PLXNA1 protein in e.coli cells involves inserting a DNA fragment encoding the Human PLXNA1 protein (986-1152aa) into a plasmid vector and transferring it to the e.coli cells. Positive cells are screened, cultured, and induced to express the PLXNA1 protein. The protein carries a N-terminal 6xHis tag. The cells are lysed to collect the recombinant Human PLXNA1 protein, which is purified through affinity purification and then identified using SDS-PAGE and subsequent staining of the gel with Coomassie Brilliant Blue. The purity of the resulting recombinant Human PLXNA1 protein exceeds 90%.

Target Background

Function

Coreceptor for SEMA3A, SEMA3C, SEMA3F and SEMA6D. Necessary for signaling by class 3 semaphorins and subsequent remodeling of the cytoskeleton. Plays a role in axon guidance, invasive growth and cell migration. Class 3 semaphorins bind to a complex composed of a neuropilin and a plexin. The plexin modulates the affinity of the complex for specific semaphorins, and its cytoplasmic domain is required for the activation of down-stream signaling events in the cytoplasm.

Gene References into Functions

Data suggest that Fyn tyrosine kinase (Fyn)-dependent phosphorylation at two critical tyrosines is a key feature of vertebrate plexin A1 (PlxnA1) and plexin A2 (PlxnA2) signal transduction. PMID: 29091353
PLEXA1 has a developmental and tumor-associated pro-angiogenic role in brain neoplasms PMID: 27506939
We thus screened 250 patients for the presence of mutations in PLXNA1, and identified different nonsynonymous mutations (p.V349L, p.V437L, p.R528W, p.H684Y, p.G720E, p.R740H, p.R813H, p.R840Q, p.A854T, p.R897H, p.L1464V, p.K1618T, p.C1744F), all at heterozygous state, in 15 patients. PMID: 28334861
Semaphorin-3a, neuropilin-1 and plexin-A1 are axonal guidance molecules that have been recently implicated in regulating bone metabolism. PMID: 26602825
a novel mutation in the PLXNA1 receptor (c.2587G>A) in newly established pancreatic cell line, is reported. PMID: 26962861
Data indicate that plexin A1-4 (PLXNA1-4) mediation of neuroanatomical traits can be detected using in vivo neuroimaging techniques. PMID: 25518740
neuropilin 1 and plexin A1 transmembrane domains interaction PMID: 24858828
Expression of Plexin A1 in gastric carcinoma was significantly higher than that in normal gastric mucosa. PMID: 17520388
Breast carcinoma cells support an autocrine pathway involving SEMA3A, plexin-A1, and NP1 that impedes their ability to chemotax. PMID: 14500350
PlexinA1 may play an important role in the occurrence and development of gastric carcinoma, and be related to tumor angiogenesis and proliferation. PMID: 18161927
In malignant pleural mesothelioma cells, plexin-A1 and VEGF-receptor 2 (VEGF-R2) are associated in a complex which are involved in survival pathways. PMID: 19176370
Data show that the expression of Sema3A receptors (neuropilin-1 (NRP-1), NRP-2, plexin A1, plexin A2, and plexin A3) significantly increased during M-CSF-mediated differentiation of monocytes into macrophages. PMID: 19480842

Hide All

Subcellular Location

Cell membrane; Single-pass type I membrane protein.

Protein Families

Plexin family

Tissue Specificity

Detected in fetal brain, lung, liver and kidney.

Database Links

HGNC: 9099

OMIM: 601055

KEGG: hsa:5361

STRING: 9606.ENSP00000377061

UniGene: Hs.432329

Code	CSB-EP883448HU
Abbreviation	Recombinant Human PLXNA1 protein, partial
MSDS	MSDS Datasheet
Size	$224
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Plexin-A1 (PLXNA1), partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage