Recombinant Human Plexin-A1(PLXNA1),partial

In Stock
Code CSB-EP883448HU
Product Type Recombinant Protein
Size $1726
Uniprot No. Q9UIW2
Relevance Coreceptor for SA3A, SA3C, SA3F and SA6D. Necessary for signaling by class 3 saphorins and subsequent rodeling of the cytoskeleton. Plays a role in axon guidance, invasive growth and cell migration. Class 3 saphorins bind to a complex composed of a neuropilin and a plexin. The plexin modulates the affinity of the complex for specific saphorins, and its Cytoplasmic domain is required for the activation of down-stream signaling events in the cytoplasm .
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Tris-based buffer,50% glycerol
Alias Semaphorin receptor NOV
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence LNAGSDVAVSVGGRPCSFSWRNSREIRCLTPPGQSPGSAPIIININRAQLTNPEVKYNYTEDPTILRIDPEWSINSGGTLLTVTGTNLATVREPRIRAKYGGIERENGCLVYNDTTMVCRAPSVANPVRSPPELGERPDELGFVMDNVRSLLVLNSTSFLYYPDPVL
Research Area Neuroscience
Source E.coli
Gene Names PLXNA1
Expression Region 986-1152aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 22.3kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Coreceptor for SEMA3A, SEMA3C, SEMA3F and SEMA6D. Necessary for signaling by class 3 semaphorins and subsequent remodeling of the cytoskeleton. Plays a role in axon guidance, invasive growth and cell migration. Class 3 semaphorins bind to a complex composed of a neuropilin and a plexin. The plexin modulates the affinity of the complex for specific semaphorins, and its cytoplasmic domain is required for the activation of down-stream signaling events in the cytoplasm (By similarity).
Subcellular Location Cell membrane, Single-pass type I membrane protein
Protein Families Plexin family
Tissue Specificity Detected in fetal brain, lung, liver and kidney.
Database Links

HGNC: 9099

OMIM: 601055

KEGG: hsa:5361

STRING: 9606.ENSP00000377061

UniGene: Hs.432329

Pathway Inhibitors of axonal regeneration

Related Products

PLXNA1 Antibodies

PLXNA1 Antibodies for Homo sapiens (Human)

PLXNA1 Antibodies for Human

PLXNA1 Proteins

PLXNA1 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.