Recombinant Human Plexin-B1 (PLXNB1), partial

In Stock
Code CSB-EP018222HU2
Abbreviation Recombinant Human PLXNB1 protein, partial
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Neuroscience
Alternative Names
Semaphorin receptor SEP
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
20-535aa
Target Protein Sequence
LQPLPPTAFTPNGTYLQHLARDPTSGTLYLGATNFLFQLSPGLQLEATVSTGPVLDSRDCLPPVMPDECPQAQPTNNPNQLLLVSPGALVVCGSVHQGVCEQRRLGQLEQLLLRPERPGDTQYVAANDPAVSTVGLVAQGLAGEPLLFVGRGYTSRGVGGGIPPITTRALWPPDPQAAFSYEETAKLAVGRLSEYSHHFVSAFARGASAYFLFLRRDLQAQSRAFRAYVSRVCLRDQHYYSYVELPLACEGGRYGLIQAAAVATSREVAHGEVLFAAFSSAAPPTVGRPPSAAAGASGASALCAFPLDEVDRLANRTRDACYTREGRAEDGTEVAYIEYDVNSDCAQLPVDTLDAYPCGSDHTPSPMASRVPLEATPILEWPGIQLTAVAVTMEDGHTIAFLGDSQGQLHRVYLGPGSDGHPYSTQSIQQGSAVSRDLTFDGTFEHLYVMTQSTLLKVPVASCAQHLDCASCLAHRDPYCGWCVLLGRCSRRSECSRGQGPEQWLWSFQPELGCLQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
56.4 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for SEMA4D. Plays a role in GABAergic synapse development. Mediates SEMA4A- and SEMA4D-dependent inhibitory synapse development. Plays a role in RHOA activation and subsequent changes of the actin cytoskeleton. Plays a role in axon guidance, invasive growth and cell migration.
Gene References into Functions
  1. Analysis of the interaction of Plexin-B1 and Plexin-B2 with Rnd family proteins shows lack of binding specificity. PMID: 29040270
  2. The positive expression of both Sema4D and PlexinB1 was found to be an independent risk factor for a worse survival in colorectal cancer. PMID: 27456345
  3. Loss of plexin B1 expression might play a pivotal role in enhancing the metastatic potential of breast cancer cells. PMID: 28739743
  4. Plexin B1 expression was regulated by TMPRSS2-ERG fusion gene in prostate cancer. PMID: 28004109
  5. Plexin-B1 mediates RhoA/integrin alphavbeta3 involved in the PI3K/Akt pathway and SRPK1 to influence the growth of glioma cell, angiogenesis, and motility in vitro and in vivo. PMID: 26944058
  6. results show that Sema4D/plexin-B1 signaling promotes the translocation of androgen receptor to the nucleus and thereby enhances AR transcriptional activity PMID: 25982277
  7. Plexin-B1 induces cutaneous squamous cell carcinoma cell proliferation, migration, and invasion by interacting with Sema4D. Plexin-B1 might serve as a useful biomarker and/or as a novel therapeutic target for cSCC. PMID: 26051877
  8. Results show that decreased expression of Sema4D, plexin-B1 and -B2 was associated with local recurrence and poor prognosis of breast neoplasm. PMID: 26035216
  9. Dysregulation of the vascular endothelial growth factor and semaphorin ligand-receptor families in prostate cancer metastasis PMID: 26341082
  10. Blocking of CD100, plexin B1 and/or B2 in adhesion experiments have shown that both CD100 and plexins act as adhesion molecules involved in monocyte-endothelial cell binding. PMID: 26275342
  11. Activation of endogenous plexin-B1 enhances cell migration and tumor invasiveness in prostate cancer cells. PMID: 23775445
  12. Data indicate that Rnd1 efficiently displaces Rac1 from its complex with Plexin-B1 but not vice versa. PMID: 23603360
  13. ErbB-2 overexpression in human breast & ovarian cancer cell lines leads to phosphorylation & activation of Plexin-B1. This was required for ErbB-2-dependent activation of RhoA & RhoC & promoted invasive behavior. PMID: 22378040
  14. PlexinB1 mutations block plexinB1-mediated signalling pathways that inhibit cell motility. PMID: 22404908
  15. evidence that Sema4D/Plexin-B1-mediated NF-kappaB activation and IL-8 production is critical in the generation a pro-angiogenic phenotype in endothelial cells PMID: 22028792
  16. Two crystal structures of the human Plexin-B1 cytoplasmic region in complex with a constitutively active RhoGTPase, Rac1, are reported. PMID: 21912513
  17. The binding of Sema4D to plexinB1 induced small GTPase Ras homolog gene family, member A activation and resulted in the phosphorylation of MAPK and Akt. PMID: 21812859
  18. plexin-B1, a target of miR-214, may function as an oncogene in human cervical cancer HeLa cells PMID: 21216304
  19. Plexin B1 abrogates integrin-dependent migration and activation of pp125(FAK). PMID: 21029396
  20. Plexin-B1 expression correlates with malignant phenotypes of serous ovarian tumors, probably via phosphorylation of AKT at Ser473 PMID: 21059203
  21. crystal structures of cognate complexes of the semaphorin-binding regions of plexins B1 and A2 with semaphorin ectodomains (human PLXNB1(1-2)-SEMA4D(ecto) and murine PlxnA2(1-4)-Sema6A(ecto)), plus unliganded structures of PlxnA2(1-4) and Sema6A(ecto) PMID: 20877282
  22. Sema4D/Plexin-B1 promotes the dephosphorylation and activation of PTEN through the R-Ras GAP activity, inducing growth cone collapse. PMID: 20610402
  23. Plexin B1 may function as a tumor promoter in melanomas not driven by c-Met activation. PMID: 20164843
  24. Data show that Plex-B1 assumes a predictive value for unfavourable outcome when co-expressed with Met. PMID: 19940359
  25. The plexin-B1/Rac interaction inhibits PAK activation and enhances Sema4D ligand binding PMID: 11937491
  26. LARG plays a critical role in plexin-B1 signaling to stimulate Rho activation and cytoskeletal reorganization. PMID: 12196628
  27. Interaction of plexin-B1 with PDZ domain-containing Rho guanine nucleotide exchange factors PMID: 12220504
  28. Plexin-B1 is an easily accessible receptor for CD100 within the immune system. The crosstalk operated by the CD100/Plexin-B1 interaction is not malignancy related but reproduces a mechanism used by normal CD5+ B cells. PMID: 12406905
  29. cleavage by proprotein convertases is a novel regulatory step for semaphorin receptors localized at the cell surface. PMID: 12533544
  30. In some human neoplastic lines, PLXB1 is overexpressed, constitutively tyrosine phosphorylated, and associated with Scatter Factor Receptors. PMID: 15184888
  31. ErbB-2-mediated phosphorylation of plexin-B1 is critically involved in Sema4D-induced RhoA activation. PMID: 15210733
  32. demonstrate that Sema4D is angiogenic in vitro and in vivo and that this effect is mediated by its high-affinity receptor, Plexin B1, and that biologic effects elicited by Plexin B1 require coupling and activation of the Met tyrosine kinase PMID: 15632204
  33. the minimal Rac1 GTPase binding domain of plexin-B1 has a ubiquitin fold, as shown by NMR PMID: 15929008
  34. Semaphorin 4D/plexin-B1 induces endothelial cell migration through the activation of PYK2, Src, and the phosphatidylinositol 3-kinase-Akt pathway PMID: 16055703
  35. Plexin-B1 contributes to trophoblast-endometrium interactions, most likely by enhancing adhesion properties. PMID: 17383649
  36. Binding of Rac1, Rnd1, and RhoD to a novel Rho GTPase interaction motif destabilizes dimerization of the plexin-B1 effector domain PMID: 17916560
  37. 13 somatic missense mutations in the cytoplasmic domain of the Plexin-B1 gene hinder Rac & R-Ras binding & R-RasGAP activity, & increase cell motility, invasion, adhesion, & lamellipodia extension. PMID: 18024597
  38. a novel mechanism by which plexin-mediated signaling can be regulated and explains how Sema4D can exert different biological activities through the differential association of its receptor with ErbB-2 and Met. PMID: 18025083
  39. NMR solution structure of the Rho GTPase binding domain; study suggests that the oncogenic behavior of the mutants can be rationalized with reference to the structure of the RBD of plexin-B1 PMID: 18275816
  40. Plexin B1 protein is absent in more than 80% of renal cell carcinomas. when we have induced plexin B1 expression with an expression vector in the renal adenocarcinoma cell line ACHN, a marked reduction in proliferation rate was produced. PMID: 18279812
  41. Mapping of the Rac1 GTPase surface that contacts the Rho GTPase binding domain of plexin-B1 by NMR confirms the plexin domain as a GTPase effector protein and regions neighboring the GTPase switch I and II regions are also involved in the interaction. PMID: 18321527
  42. Plexin B1 expression is reduced in the group of "uncoupled" stem cell-like breast cancer tumors PMID: 18417270
  43. Plexin-B1 is a dual functional GTPase activating protein for R-Ras and M-Ras, remodelling axon and dendrite morphology, respectively. PMID: 19444311
  44. B-Raf/MKK/ERK provides a permissive environment for melanoma genesis by modulating plexin B1. PMID: 19483722
  45. show here that activation of plexin-B1 by Semaphorin 4D and its subsequent tyrosine phosphorylation creates docking sites for the SH2 domains of phospholipase Cgamma. PMID: 19805522
  46. the monomeric intracellular plexin-B1 binds R-Ras but not H-Ras. These findings suggest that the monomeric form of the intracellular region is primed for GAP activity and extend a model for plexin activation. PMID: 19843518

Show More

Hide All

Subcellular Location
[Isoform 1]: Cell membrane; Single-pass type I membrane protein.; [Isoform 2]: Secreted.; [Isoform 3]: Secreted.
Protein Families
Plexin family
Tissue Specificity
Highly expressed in fetal kidney, and at slightly lower levels in fetal brain, lung and liver.
Database Links

HGNC: 9103

OMIM: 601053

KEGG: hsa:5364

STRING: 9606.ENSP00000296440

UniGene: Hs.476209

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*