Recombinant Human Podocin (NPHS2), Partial

In Stock
Code CSB-EP885678HU1(F2)
Abbreviation Recombinant Human NPHS2 protein, partial
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
NPHS2
Uniprot No.
Research Area
Cell Biology
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
124-315aa
Target Protein Sequence
CVKVVQEYERVIIFRLGHLLPGRAKGPGLFFFLPCLDTYHKVDLRLQTLEIPFHEVALDSVTCIWGIKVERIEIKDVRLPAGLQHSLAVEAEAQRQAKVRMIAAEAEKAASESLRMAAEILSGTPAAVQLRYLHTLQSLSTEKPSTVVLPLPFDLLNCLSSPSNRTQGSLPFPSPSKPVEPLNPKKKDSPML
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
28.2 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Plays a role in the regulation of glomerular permeability, acting probably as a linker between the plasma membrane and the cytoskeleton.
Gene References into Functions
  1. In conclusion, the authors identified SNX9 as a facilitator of podocin endocytosis in severe podocyte injury and demonstrated the expression of SNX9 in the podocytes of both nephropathy model mice and human patients with irreversible glomerular disease. PMID: 28266622
  2. Mutations of NPHS2 gene are common among Egyptian children with Steroid-resistant nephrotic syndrome. PMID: 28385484
  3. C-terminal oligomerization of podocin can mediate both a dominant negative effect and interallelic complementation. Interallelic interactions of NPHS2 are not restricted to the R229Q variant and have to be considered in compound heterozygous individuals. PMID: 29660491
  4. Heterozygous deletion in the NPHS2 gene involved in familial steroid-resistant nephrotic syndrome with early onset, slow progression and dominant inheritance pattern. PMID: 27573339
  5. polymorphisms predicted in this study might be disease causing in the NPHS2 gene and may have influence on the therapeutic response of nephrotic syndrome patients PMID: 28712774
  6. Mutations in podocin alter the innate intraprotein interactions affecting the native structure of podocin and its ability to form critical complex with subpodocyte proteins PMID: 27193387
  7. NPHS2 mutations/SNPs serve as important molecular markers in treating children with early stage idiopathic nephrotic syndrome. PMID: 26820844
  8. Two siblings with CRB2 -related syndrome were both heterozygous for a variant in NPHS2. PMID: 27004616
  9. This study shows that p.R229Q and p.A284V are the most frequent variants in Chilean children with steroid resistant nephrotic syndrome; it is the first time that this relationship has been reported in Chilean children PMID: 26455708
  10. Ubiquitin ligase Ubr4 is a key component of the podocin interactome purified from podocytes. Ubiquitylation of one podocin site, K301, do not only target podocin for proteasomal degradation, but may also affect stability and disassembly of the multimeric complex. PMID: 26792178
  11. Oligoallelic amino acid mutations in podocin may be potential causative mutations for proteinuria (meta-analysis) PMID: 26211502
  12. The results support the hypothesis that certain hypomorphic podocin variants may act as adverse genetic modifiers when co-inherited with COL4A3 mutations PMID: 26138234
  13. translocation of podocin by endocytosis could be a key traffic event of critical podocyte injury and that the podocin gap could indicate the prognosis of IgA nephropathy. PMID: 25676004
  14. NPHS2 mutations account for only 15% of nephrotic syndrome cases. PMID: 26420286
  15. NPHS2 rs61747728 variant is not associated with nephrotic syndrome in children. PMID: 25599733
  16. A single gene is involved in the development of steroid-resistant nephrotic syndrome. PMID: 25349199
  17. NPHS2 gene mutations are not a major cause of chronic renal insufficiency caused by late SRNS in Chinese southern infants PMID: 25112471
  18. for adult-onset disease (onset age > 18), the homozygous variant could be a potential predictor of hereditary nephrotic syndrome; the p.R229Q allele cannot currently be considered a risk factor for predicting focal segmental glomerulosclerosis. PMID: 24715228
  19. Thus, NPHS2 gene showed R229Q polymorphism and patients achieved partial remission to therapy. PMID: 24519673
  20. Variants in NPHS2, SDCCAG8 and near BMP4 appear to interact with APOL1 to modulate the risk for non-diabetic end stage kidney disease in african americans. PMID: 24157943
  21. NPHS2 mutations are prevalent in Indian patients with , Idiopathic, steroid-resistant Nephrotic syndrome and this may in part explain the less favourable prognosis reported in these patients. PMID: 24674236
  22. Four patients had homozygous c.413G>A (p.Arg138Gln) NPHS2 mutations; one subject was homozygous for c.868G>A (p.Val290Met) NPHS2. PMID: 24856380
  23. Case Report: novel NPHS2 sequence variant in a girl with steroid-resistant nephrotic syndrome and focal and segmental glomerulosclerosis. PMID: 24969201
  24. the frequency of identified disease causing mutations (NPHS1 and NPHS2) in children with steroid-resistant nephrotic syndome is 11.4%, and they show no response to treatment. PMID: 24413855
  25. The results suggest that the functions of Nephrin and Podocin are highly conserved between the zebrafish pronephros and mammalian metanephros. PMID: 24337247
  26. 25 novel pathogenic mutations have been identified in steroid-resistant nephrotic syndrome. They includes missense, nonsense, small insertions, small deletions, splicing, indel mutations, and a mutation in the stop codon. PMID: 24227627
  27. Mutations of podocin were frequent among south-west Iranian pediatric population with steroid-resistant nephrotic syndrome. PMID: 24072147
  28. the carboxyl terminus of podocin/MEC-2 has to be placed at the inner leaflet of the plasma membrane to mediate cholesterol binding and contribute to ion channel activity. PMID: 24596097
  29. The NPHS2 gene p.R229Q polymorphism does not present in an Iranian-Azeri population with late-onset steroid-resistance nephrotic syndrome. PMID: 24072153
  30. present an autosomal-recessive disorder, nephrotic syndrome type 2 (MIM 600995), in which the pathogenicity of an NPHS2 allele encoding p.Arg229Gln depends on the trans-associated 3' mutation PMID: 24509478
  31. Focal segmental glomerulosclerosis patients with NPHS2 homozygous p.R229Q should be screened for the causative mutation in a second gene. PMID: 23800802
  32. The podocin mutation R229Q may play a role in the pathogenesis of focal segmental glomerulosclerosis and in early recurrence after transplantation, but does not allow accurate prediction of recurrence or the associated potential for prevention. PMID: 23982418
  33. study identified NPHS2 mutations in Mexican children with nephrotic syndrome; Podocin heterozygous missense mutations L139R and L142P were found; the former was found in steroid-sensitive and steroid-resistant children; the latter was found in a steroid-resistant child PMID: 23913389
  34. analysis of NPHS2 mutations in Polish patients with steroid-resistant nephrotic syndrome reveals a founder effect PMID: 23645318
  35. A second short isoform of podocin was found to be expressed in the kidney. PMID: 23648087
  36. an Iranian family of familial steroid-resistant nephrotic syndrome with 3 affected children was reported in which NPHS2 gene has been detected; in exon 4 of the NPHS2 gene, c.503G>A X R168H homozygous mutation was found; both parents of index case were heterozygous carrier with the same mutation compatible with recessive inheritance PMID: 23013956
  37. Suggest screening for NPHS2 p.R229Q/p.V290M mutations in Central and Eastern European patients with late-onset steroid-resistant nephrotic syndrome. PMID: 23242530
  38. A total of 7 homozygous (6 novel) mutations were found in the NPHS1 gene and 4 homozygous mutations in the NPHS2 gene. PMID: 22565185
  39. We examined the frequency and spectrum of podocin NPHS2 mutations in Indian children with sporadic steroid resistant nephrotic syndrome. Of 25 children screened, only one (4%) had a pathogenic mutation resulting in a stop codon. PMID: 22080622
  40. NPHS2 mutations are rare in patients with adult onset of FSGS/MCD. The R229Q polymorphism is frequent in the Czech population and probably could have some influence on IGAN PMID: 22578956
  41. NPHS2 polymorphisms were identified in northern Chinese IgA nephropathy patients. The frequencies of NPHS2 T allele and TT/CT genotype were the protective factors for urinary protein. PMID: 22321327
  42. in patients with familial hematuria, NPHS2-R229Q predisposes to proteinuria and end-stage kidney disease PMID: 22228437
  43. NPHS2 mutations account for a significant proportion of all nephrotic patients, roughly corresponding to a mutation detection rate of 45-55% in families with recessive traits and 8-20% of sporadic cases. PMID: 22120861
  44. we are for the first time able to prove the expression of a novel podocin isoform (isoform 2), exclusively and constitutively expressed in human podocytes, and reveal singular extrarenal podocin expression in human and murine testis PMID: 21499232
  45. Data show that the main slit diaphragm proteins, nephrin and podocin, are affected from the earlier stages of lupus nephritis and their expression correlates with disease histology. PMID: 21478284
  46. The urinary mRNA profiles of synaptopodin, podocalyxin, CD2-AP, alpha-actin4, and podocin were found to increase with the progression of diabetic nephropathy. PMID: 21655212
  47. NPHS2 mutation analysis has a clinical value in both childhood- and adult-onset steroid-resistant nephrotic syndrome patients. PMID: 20947785
  48. Novel mutations in steroid-resistant nephrotic syndrome diagnosed in Tunisian children were detected in NPHS2. PMID: 21125408
  49. plasmapheresis can result in clinical improvement and stabilization of SRNS caused by podocine mutation. A combined heterozygous form of two NPHS2 gene mutations (p.R138Q and p.V290M) was diagnosed PMID: 21171529
  50. NPHS2 mutations are not a major cause of familial steroid-resistant nephrotic syndrome in Southern Chinese Han ethnic group. PMID: 19099831

Show More

Hide All

Involvement in disease
Nephrotic syndrome 2 (NPHS2)
Subcellular Location
[Isoform 1]: Cell membrane; Peripheral membrane protein.; [Isoform 2]: Endoplasmic reticulum.
Protein Families
Band 7/mec-2 family
Tissue Specificity
Almost exclusively expressed in the podocytes of fetal and mature kidney glomeruli.
Database Links

HGNC: 13394

OMIM: 600995

KEGG: hsa:7827

STRING: 9606.ENSP00000356587

UniGene: Hs.412710

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*