Recombinant Human Poly [ADP-ribose] polymerase tankyrase-1 (TNKS), partial

Code CSB-MP024004HU1
Abbreviation Recombinant Human TNKS protein, partial
MSDS
Size $190
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥90% as determined by SDS-PAGE.
Activity
Not Test
Target Names
TNKS
Uniprot No.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
ADP-ribosyltransferase diphtheria toxin-like 5;Poly [ADP-ribose] polymerase 5A;Protein poly-ADP-ribosyltransferase tankyrase-1;TNKS-1;TRF1-interacting ankyrin-related ADP-ribose polymerase;Tankyrase I;Tankyrase-1
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
1030-1317aa
Target Protein Sequence
NISQFLKSLGLEHLRDIFETEQITLDVLADMGHEELKEIGINAYGHRHKLIKGVERLLGGQQGTNPYLTFHCVNQGTILLDLAPEDKEYQSVEEEMQSTIREHRDGGNAGGIFNRYNVIRIQKVVNKKLRERFCHRQKEVSEENHNHHNERMLFHGSPFINAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPTHKDRSCYICHRQMLFCRVTLGKSFLQFSTMKMAHAPPGHHSVIGRPSVNGLAYAEYVIYRGEQAYPEYLITYQIMKPEAPS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
100.9 kDa
Protein Length
Partial
Tag Info
N-terminal HSA-tagged and C-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Poly-ADP-ribosyltransferase involved in various processes such as Wnt signaling pathway, telomere length and vesicle trafficking. Acts as an activator of the Wnt signaling pathway by mediating poly-ADP-ribosylation (PARsylation) of AXIN1 and AXIN2, 2 key components of the beta-catenin destruction complex: poly-ADP-ribosylated target proteins are recognized by RNF146, which mediates their ubiquitination and subsequent degradation. Also mediates PARsylation of BLZF1 and CASC3, followed by recruitment of RNF146 and subsequent ubiquitination. Mediates PARsylation of TERF1, thereby contributing to the regulation of telomere length. Involved in centrosome maturation during prometaphase by mediating PARsylation of HEPACAM2/MIKI. May also regulate vesicle trafficking and modulate the subcellular distribution of SLC2A4/GLUT4-vesicles. May be involved in spindle pole assembly through PARsylation of NUMA1. Stimulates 26S proteasome activity.
Gene References into Functions
  1. Either tankyrase 1 or 2 is sufficient to maintain telomere length, but both are required to resolve telomere cohesion and maintain mitotic spindle integrity. Tankyrases are required for Notch2 to exit the plasma membrane and enter the nucleus to activate transcription. PMID: 29263426
  2. Finally, through functional validation, we uncovered a role for TNKS/2 in peroxisome homeostasis and determined that this function is independent of TNKS enzyme activities. PMID: 28723574
  3. The data indicate that the sterile alpha motif domain polymerization is critical for TNKS1 catalytic activity and allows TNKS1 to efficiently access cytoplasmic signaling complexes. PMID: 27499439
  4. Polymerization is required for Tankyrase to drive beta-catenin-dependent transcription. The polymeric state supports PARP activity and allows Tankyrase to effectively access destruction complexes through enabling avidity-dependent AXIN binding. PMID: 27494558
  5. In late S/G2 phase, the DNA damage-responsive E3 ligase RNF8 conjugates K63-linked ubiquitin chains to tankyrase 1, while in G1 phase such ubiquitin chains are removed by BRISC, an ABRO1/BRCC36-containing deubiquitinase complex. PMID: 27993934
  6. These structural insights will be invaluable for the functional and biophysical characterization of TNKS1/2, including the role of TNKS oligomerization in protein poly(ADP-ribosyl)ation (PARylation) and PARylation-dependent ubiquitylation. PMID: 27328430
  7. Results describe the structure of three consecutive TNKS- ankyrin repeat clusters (ARCs). Binding analysis indicates specific ARC pairs engage bivalent binding partner Axin1, and that both rigid and flexible ARC connections form an adaptable TNKS binding platform. PMID: 27594684
  8. we show for the first time that Tankyrase 1 inhibitior XAV939 was able to significantly increase the apoptosis induced by 5-FU/DDP, accompanied by the protein expression level alternation of b-catenin, Axin and CSC markers in colon cancer cells. PMID: 26820603
  9. HCMV modulates the activity of TNKS to induce Axin1, resulting in inhibition of the beta-catenin pathway. PMID: 26729153
  10. Data show that E7449 represents a dual Poly(ADP-ribose) Polymerase 1/2 and tankyrase 1/2 inhibitor which has the advantage of targeting Wnt/beta-catenin signaling addicted tumors. PMID: 26513298
  11. TNKS1 SNPs (rs11991621 rs10503380, and rs7015700) were associated with non-small cell lung cance risk, whereas rs6601328 and rs12541709 inversely associated with risk PMID: 26617760
  12. Tankyrase inhibition is a potential therapeutic approach for treating a subgroup HCC with aberrant WNT/beta-catenin signaling pathway. PMID: 26246473
  13. TNKS1 is recruited to DNA lesions by MDC1 and promotes homologous recombination in response to DNA double strand breaks. PMID: 26845027
  14. Copy number deletion on TNKS was associated with a 1.37-fold decreased risk for osteoarthritis. PMID: 25880085
  15. tankyrase-mediated PARsylation is promoted by nutritional energy stimulated NAD+ in insulinoma cells PMID: 25876076
  16. Data indicate that tankyrase (Tnks) inhibitors impact telomere length maintenance independently of their affects on Wnt/beta-catenin signaling. PMID: 25939383
  17. We demonstrate for the first time that tankyrase inhibition triggers reduced cell growth and differentiation of OS cells PMID: 24403055
  18. Studies show a significant interaction of IWR1 with acidic and polar residues (Asp and Tyr) in the hydrophobic region at the induced pocket of TNKS1/TNKS2. These two residues are the key for the mechanism of inhibition of TNKS proteins. PMID: 24291818
  19. A novel function of TNKS in the relief of a feedback loop induced by MEK inhibition on FGFR2 signaling pathway. PMID: 24747911
  20. This limits the therapeutic value of TNKSi in colorectal carcinomas. PMID: 24419084
  21. The present study suggests that combination of the inhibitors of telomerase and tankyrase can be used as a strategy for the treatment of lung cancer in humans. PMID: 23933993
  22. Data indicate a basis for development of flavones as tankyrase inhibitors and suggest the development of other structurally related inhibitors. PMID: 24116873
  23. tankyrase-1 activity is required for initiation of T-oligo induced damage responses including p53 phosphorylation and reduction of cellular proliferation. PMID: 23800953
  24. The data suggest that PARsylation of Miki by tankyrase-1 is a key initial event promoting prometaphase. PMID: 22864114
  25. CPAP degradation and function is controlled by the poly(ADP-ribose) polymerase tankyrase 1. PMID: 22699936
  26. GMD inhibits tankyrase 1 poly(ADP-ribose) polymerase activity in vitro, dependent on the GMD tankyrase 1 binding motif. In vivo, depletion of GMD led to degradation of tankyrase 1, dependent on the catalytic PARP activity of tankyrase 1. PMID: 22645305
  27. crystal structure of the catalytic domain of TNKS1 in complex with IWR2, which reveals a novel binding site for tankyrase inhibitors PMID: 22438990
  28. TNKS1 may have a key role in astrocytomas through its involvement in the Wnt/beta-catenin signaling pathway. PMID: 22154485
  29. Phosphorylation of TNKS1 by Plk1 may help regulate mitotic spindle assembly and promote telomeric chromatin maintenance. PMID: 21818122
  30. In the early phase of infection, HSV ICP0 interacts with tankyrase 1 and mediates its nuclear translocation. PMID: 22013039
  31. High tankyrase 1 and telomerase expression is associated with gastric cancer. PMID: 21455637
  32. Tankyrase 1-PARP regulates stabilization of the NHEJ protein DNA-PKcs, revealing a new aspect of DNA-PKcs regulation that impacts both telomere and DNA repair functions. PMID: 21037379
  33. inhibition of tankyrase 1 could shorten telomere length and play a synergistic role with telomerase inhibitors in telomere length shortening in the SGC-7901 gastric cancer cell line PMID: 20811689
  34. These observations suggest that tankyrase-1 assembly to large protein complexes masks its telomeric function. PMID: 20696165
  35. Data show that 4-oxo-4-HPR inhibited tubulin polymerization and modulated gene expression of spindle aberration associated genes Kif 1C, Kif 2A, Eg5, Tara, tankyrase-1, centractin, and TOGp. PMID: 19996280
  36. Data suggest that pADPr provides a dynamic cross-linking function at spindle poles by extending from covalent modification sites on PARP-5a and NuMA and binding noncovalently to NuMA and that this function helps promote assembly of exactly two poles. PMID: 19759176
  37. The telomeric poly(ADP-ribose) polymerase, tankyrase 1, contains multiple binding sites for telomeric repeat binding factor 1 (TRF1) and a novel acceptor, 182-kDa tankyrase-binding protein (TAB182). PMID: 11854288
  38. Identification of a binding motif shared by IRAP TAB182, and human TRF1 but not mouse TRF1 PMID: 12080061
  39. Results describe the expression and enzymatic characterization of full-length tankyrase 1 and a fragment, termed T-PARP, spanning the poly(ADP-ribose) polymerase domain. PMID: 12381316
  40. Tankyrase 1 interacts with Mcl-1 proteins and inhibits their regulation of apoptosis PMID: 12475993
  41. co-immunoprecipitation of endogenous proteins in 293T cells confirms physiological relevance of TNKS as interaction partner of FBP17 PMID: 14596906
  42. Results provide evidence that specific ankyrin repeat cluster-TRF1 interactions play roles in the essential catalytic function of tankyrase 1. PMID: 14966275
  43. telomeres may require a unique tankyrase 1-dependent mechanism for sister chromatid resolution before anaphase PMID: 15064417
  44. TIN2 protected TRF1 from poly(ADP-ribosyl)ation by tankyrase 1 without affecting tankyrase 1 automodification. PMID: 15133513
  45. TNKS1 bound to Epstein-Barr virus origin of plasmid replication in coimmunoprecipitation experiments with transfected cell lysates. PMID: 15795250
  46. The role of TNKS in the poly(ADP-ribosyl)ation of the mitotic spindle apparatus is reported. PMID: 16076287
  47. tankyrase-1 appears to protect cells by preventing genotoxins from activating PARP 1-mediated reactions such as PARP 1 automodification and NAD(+) consumption PMID: 16132700
  48. Cell-cell contact makes tankyrase associate with the lateral membrane. PARsylating activity causes translocation to cytosol, ubiquitination & proteasomal degradation. Recruitment to this site suggests a role in polarized protein targeting in epithelium. PMID: 16884355
  49. tankyrase1 is a poly(ADP-ribose) polymerase with roles in telomere length control by the TRF1 component of the shelterin complex PMID: 17561506
  50. TNKL and TNKS are aberrantly expressed in colon tumors and contain multiple epitopes that induce humoral and cellular immune responses in cancer patients PMID: 18026951

Show More

Hide All

Subcellular Location
Cytoplasm. Golgi apparatus membrane; Peripheral membrane protein. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Nucleus, nuclear pore complex. Chromosome, telomere. Cytoplasm, cytoskeleton, spindle pole.
Tissue Specificity
Ubiquitous; highest levels in testis.
Database Links

HGNC: 11941

OMIM: 603303

KEGG: hsa:8658

STRING: 9606.ENSP00000311579

UniGene: Hs.370267

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*