Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-EP019131HU |
| Product Type | Recombinant Protein |
| Size |
US$1726Purchase it in Cusabio online store (Shop online in the US. Customers outside the US, please order from local distributors.) |
| Uniprot No. | P20742 |
| Lead Time | 3-7 business days |
| Relevance | Is able to inhibit all four classes of proteinases by a unique 'trapping' mechanism. This protein has a peptide stretch, called the 'bait region' which contains specific cleavage sites for different proteinases. When a proteinase cleaves the bait region, a conformational change is induced in the protein which traps the proteinase. The entrapped enzyme rains active against low molecular weight substrates (activity against high molecular weight substrates is greatly reduced). Following cleavage in the bait region a thioester bond is hydrolyzed and mediates the covalent binding of the protein to the proteinase. |
| Image |
|
| Storage Buffer | Tris-based buffer,50% glycerol |
| Alias | C3 and PZP-like alpha-2-macroglobulin domain-containing protein 6 |
| Species | Homo sapiens (Human) |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Sequence | MKPEAELSVSSVYNLLTVKDLTNFPDNVDQQEEEQGHCPRPFFIHNGAIYVPLSSNEADIYSFLKGMGLKVFTNSKIRKPKSCSVIPSVSAGAVGQGYYGAGLGVVERPYVPQLGTYNVIPLNNEQSSGPVPETVRSYFPETWIWELVAVNSSGVAEVGVTVPDTITEWKAGAFCLSEDAGLGISSTASLRAFQPFFVELTMPYSVIRGEVFTLKATVLNYLPKCIRAEGIEQEKTFSSMTCASGANVSEQLSLKLPSNVVKESARASFSVLGDILGSAMQNIQNLLQMPYGCGEQNMVLFAPNIYVLNYLNETQQLTQEIKAKAVGYLITGYQRQLNYKHQDGSYSTFG |
| Research Area | Neuroscience |
| Source | E.coli |
| Gene Names | PZP |
| Expression Region | 472-821aa |
| Tag Info | N-terminal 6xHis-tagged |
| Mol. Weight | 42.3kDa |
| Protein Description | Partial |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | Is able to inhibit all four classes of proteinases by a unique 'trapping' mechanism. This protein has a peptide stretch, called the 'bait region' which contains specific cleavage sites for different proteinases. When a proteinase cleaves the bait region, a conformational change is induced in the protein which traps the proteinase. The entrapped enzyme remains active against low molecular weight substrates (activity against high molecular weight substrates is greatly reduced). Following cleavage in the bait region a thioester bond is hydrolyzed and mediates the covalent binding of the protein to the proteinase. |
| Subcellular Location | Secreted |
| Protein Families | Protease inhibitor I39 (alpha-2-macroglobulin) family |
| Tissue Specificity | Plasma. Prominent constituent of late-pregnancy sera. |
| Database Links |
HGNC: 9750 OMIM: 176420 STRING: 9606.ENSP00000261336 UniGene: Hs.707491 |
PZP Antibodies for Human
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA019131HC01HU | PZP Antibody, FITC conjugated | Human | ELISA |
| CSB-PA019131HA01HU | PZP Antibody | Human | ELISA |
| CSB-PA019131HD01HU | PZP Antibody, Biotin conjugated | Human | ELISA |
| CSB-PA019131HB01HU | PZP Antibody, HRP conjugated | Human | ELISA |
PZP Antibodies for Homo sapiens (Human)
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA019131GA01HU | PZP Antibody | Human | ELISA,WB,IHC |
PZP Proteins for Homo sapiens (Human)
| Code | Product Name | Source |
|---|---|---|
| CSB-YP019131HU | Recombinant Human Pregnancy zone protein(PZP),partial | Yeast |
| CSB-BP019131HU CSB-MP019131HU |
Recombinant Human Pregnancy zone protein(PZP) ,partial | Baculovirus Mammalian cell |
PZP ELISA Kit for Homo sapiens (Human)
| Code | Product Name | Sample Types | Sensitivity |
|---|---|---|---|
| CSB-EL019131HU | Human Pregnancy zone protein(PZP) ELISA kit | serum, plasma, tissue homogenates | 2 μg/mL |
Recombinant Human Thyroid hormone receptor beta(THRB)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Fibrinogen beta chain(FGB),partial
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Corticosteroid-binding globulin(SERPINA6)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Suppressor of cytokine signaling 2(SOCS2)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Mouse Interferon alpha/beta receptor 2(Ifnar2),partial,Yeast
Express system: Yeast
Species: Mus musculus (Mouse)
Recombinant Human Pre-mRNA-splicing factor SPF27(BCAS2)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Bovine Metalloproteinase inhibitor 4(TIMP4)
Express system: E.coli
Species: Bos taurus (Bovine)
