Recombinant Human Pro-adrenomedullin (ADM), partial

Code CSB-YP001370HU
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP001370HU
MSDS
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP001370HU-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP001370HU
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP001370HU
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
Uniprot No.
Alternative Names
Pro-adrenomedullin [Cleaved into: Adrenomedullin; AM; Proadrenomedullin N-20 terminal peptide; ProAM N-terminal 20 peptide; PAMP; ProAM-N20] ADM AM
Species
Homo sapiens (Human)
Expression Region
95-146
Target Protein Sequence
YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY
Protein Length
Partial
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
AM and PAMP are potent hypotensive and vasodilatator agents. Numerous actions have been reported most related to the physiologic control of fluid and electrolyte homeostasis. In the kidney, am is diuretic and natriuretic, and both am and pamp inhibit aldosterone secretion by direct adrenal actions. In pituitary gland, both peptides at physiologically relevant doses inhibit basal ACTH secretion. Both peptides appear to act in brain and pituitary gland to facilitate the loss of plasma volume, actions which complement their hypotensive effects in blood vessels.
Gene References into Functions
  1. Up-regulated mRNA and protein levels of proadrenomedullin (ProADM) during acute myocardial infarction in mice and humans. PMID: 30166452
  2. ADM was an upstream molecule of HIF-1alpha/VEGF and it promoted angiogenesis through upregulating HIF-1alpha/VEGF in epithelial ovarian cancer. PMID: 28091613
  3. Identifying a marker(adrenomedullin) for pancreatic cancer among high-risk patients such as new-onset diabetics might lead to the identification of a subpopulation needing to be screened in order to enable early diagnosis and treatment of a highly lethal tumor PMID: 29192743
  4. High ADM expression is associated with lymph node metastasis in oral and oropharyngeal squamous cell carcinoma. PMID: 29590186
  5. High expression of ADM is correlated with sunitinib-resistant renal cell carcinoma. PMID: 27556517
  6. results indicate a novel function of adrenomedullin (ADM) in pancreatic ductal adenocarcinoma (PDAC), and suggest ADM is a promising target in the treatment of PDAC. PMID: 27391260
  7. Report an association of elevated ProADM blood levels and 10-year all-cause mortality in a primary care cohort with respiratory tract infections. PMID: 28676115
  8. These results indicate that elevated ADM may be involved in the etiology of schizophrenia through the regulation of heat shock protein signaling. PMID: 27776076
  9. our results pointed towards two MR-pro-ADM threshold values that appear to predict with a good degree of accuracy the patient's need for non-invasive mechanical ventilation, endotracheal intubation, or intensive care. This aspect, however, deserves further investigation PMID: 29161297
  10. promotes the proliferation and inhibits apoptosis of dental pulp stem cells PMID: 27475098
  11. MR-proADM but not copeptin was significantly associated with prognosis of COPD exacerbations at 30 days. PMID: 28408815
  12. Findings indicate the importance of cancer-associated fibroblasts (CAFs)-derived adrenomedullin (AM) pathway in growth of breast carcinoma and in neovascularization by supplying and amplifying signals that are essential for pathologic angiogenesis. PMID: 28178651
  13. This study indicates that in children with community-acquired pneumonia, sTREM-1, Midregional-proANP, and Midregional-proADM blood levels have poor abilities to differentiate bacterial from viral diseases or to identify severe cases. PMID: 27846213
  14. Admission MR-proADM concentrations provide strong prognostic information in patients with acute HF, but modest diagnostic information in patients with acute dyspnea. PMID: 28065681
  15. Mouse and human heart valves expressed mRNAs for the CRL ligands adrenomedullin (AM), adrenomedullin-2 (AM-2) and calcitonin gene-related peptide (CGRP) and for their receptor components, i.e., CRL and receptor-activity-modifying proteins 1-3. PMID: 27553639
  16. SHH acted exclusively in a paracrine fashion on pancreatic stellate cells and influenced the growth of Pancreatic Cancer cells only indirectly, ADM could directly impact the growth of both Pancreatic Cancer cells and pancreatic stellate cells . PMID: 27246849
  17. MR-proADM showed a significant association with BP reduction after 6 months PMID: 27153479
  18. Elevated plasma level of MR-proADM, determined 24 h after diagnosis of Cardiogenic shock could be a predictor of in-hospital mortality in patients with acute myocardial infarction complicated by CS. PMID: 27788594
  19. Our findings showed that adrenomedullin expression increased in progression from benign endometrium to endometrial intraepithelial neoplasia and type-1 adenocarcinoma PMID: 26972419
  20. The levels of IL-8, IL-12, and adrenomedullin may be good indicators of embryo and oocyte quality in endometriosis patients undergoing IVF. PMID: 27491770
  21. Evidence show that ADM could affect the growth and differentiation of leukemia cells by modulating RAMPs/CRLR expression, PI3K/Akt cascade and the ERK/MAPK signaling pathway. PMID: 26847772
  22. A panel of three biomarkers (MR-proANP, PCT, and MR-proADM) in patients presenting to the emergency unit with acute dyspnea provides information about the probability of acute heart failure, nonsurvival, and pneumonia. PMID: 26748496
  23. Higher levels of Proadrenomedullin are associated with Primary Graft Dysfunction and Mortality Following Lung Transplantation. PMID: 26461449
  24. conclusion supplementation with selenium and coenzyme Q10 during four years resulted in less concentration of both copeptin and MR-proADM PMID: 26662217
  25. High Adrenomedullin expression is associated with Malignant Pleural Mesothelioma. PMID: 26762744
  26. Among adrenomedullin, CRP, and PCT, procalcitonin demonstrates the highest correlation with the severity of infection. PMID: 26271020
  27. we found significantly lower plasma MR-proADM levels in patients with elevated anxiety scores PMID: 26342564
  28. AM is expressed by peritoneal mesothelial cells and actively amidated in the abdominal cavity of patients undergoing peritoneal dialysis. PMID: 23564381
  29. Results suggest that ADM plays an important role in intrahepatic cholangiocellular carcinoma metastasis, and that ADM signaling of epithelial-mesenchymal transition may represent a valuable therapeutic target in cancer patients. PMID: 26043778
  30. targeting of the ADM/ADM acceptors/ERK1/2/Bcl-2 pathway may provide a potential strategy through which to induce the apoptosis of osteosarcoma cells. PMID: 26035796
  31. In addition to its role in the complement system, complement factor H has an another role, as a binding protein for the regulatory peptide adrenomedullin. (Review) PMID: 26597206
  32. Proadrenomedullin was increased in complicated vs. uncomplicated community acquired pediatric pneumonia. PMID: 26286191
  33. AM expression gets rapidly activated by hypoxia through a HIF-1alpha mediated mechanism, thus characterizing AM as a major survival factor for tumour cells PMID: 25475159
  34. tested the hypothesis that AM-deficient fetal primary pulmonary microvascular endothelial cells (HPMEC) will have increased oxidative stress, inflammation, and cytotoxicity compared to AM-sufficient HPMEC upon exposure to hyperoxia PMID: 26196743
  35. Diabetes status had no impact on midregional proadrenomedullin concentrations or in the predictive value of heart failure. PMID: 25528198
  36. Allelic variation in ADM and increased plasma MR-proADM are associated with susceptibility to progression of diabetic kidney disease in type 2 diabetic patients. PMID: 25948679
  37. Adrenomedullin potentiates osteolytic responses in bone to metastatic breast cancer cells. PMID: 25439669
  38. Plasma adrenomedullin level is enhanced in nasopharyngeal carcinoma.Adrenomedullin is correlated with stage progression and with long-term survival of nasopharyngeal carcinoma patients. PMID: 25433141
  39. There was a significant increase in plasma AM, VCAM-1, and ICAM-1, while a significant decrease in plasma basic-Fibroblast growth factor (b-FGF) in diabetic patients with peripheral vascular disease (p < 0.05). PMID: 25287126
  40. the ADM gene has a role in the modulation of peripheral vascular tone PMID: 25053723
  41. plasma mid-regional pro-adrenomedullin helps predict pre-eclampsia PMID: 24853905
  42. ADM genotype AA was associated with the highest values of systolic and diastolic blood pressure (BP), while CACNB2 genotype CC carriers had the highest values of diastolic BP in childhood. PMID: 25313554
  43. higher plasma adrenomedullin levels on presentation are associated with clinical severity and worse outcomes in patients with acute spontaneous aneurysmal subarachnoid hemorrhage PMID: 25009125
  44. midregional pro-adrenomedullin plasma concentrations blunted in severe preeclampsia PMID: 25043691
  45. adrenomedullin acts as a critical promoter of cell cycle progression in hepatocellular carcinoma cells PMID: 24927229
  46. Elevated plasma adrenomedullin concentration is highly associated with 3-month clinical outcomes and early neurological deterioration of patients with acute intracerebral hemorrhage. PMID: 24457114
  47. Results demonstrate a novel function of HIFs in regulating ADM expression by enhancing its pre-mRNA splicing. PMID: 24523299
  48. N-terminal PEGylated Adrenomedullin stimulated cAMP production in vitro, showing lessened acute hypotensive action and a prolonged plasma half-life in comparison with native Adrenomedullin peptide in vivo. PMID: 24874704
  49. the AM system is widely expressed in human thymus from newborns; both AM1 receptor components CLR and RAMP2, but not RAMP3, are not associated with the plasma membrane of TECs and thymocytes but are located intracellularly, notably in the nucleus PMID: 24831942
  50. The correlation of ADM expression level with the measures of stroke severity implicates ADM -a potential blood bio-marker in studies of ischemic stroke. PMID: 23968191

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Adrenomedullin family
Tissue Specificity
Highest levels found in pheochromocytoma and adrenal medulla. Also found in lung, ventricle and kidney tissues.
Database Links

HGNC: 259

OMIM: 103275

KEGG: hsa:133

STRING: 9606.ENSP00000278175

UniGene: Hs.441047

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1