Recombinant Human Probable JmjC domain-containing histone demethylation protein 2C(JMJD1C) ,partial

In Stock
Code CSB-EP624030HU
Product Type Recombinant Protein
Size US$1726Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. Q15652
Lead Time 3-7 business days
Abbreviation JMJD1C
Relevance Probable histone demethylase that specifically demethylates 'Lys-9' of histone H3, thereby playing a central role in histone code. Demethylation of Lys residue generates formaldehyde and succinate. May be involved in hormone-dependent transcriptional activation, by participating in recruitment to androgen-receptor target genes
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Jumonji domain-containing protein 1C Thyroid receptor-interacting protein 8
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MPARYEDLLKSLPLPEYCNPEGKFNLASHLPGFFVRPDLGPRLCSAYGVVAAKDHDIGTTNLHIEVSDVVNILVYVGIAKGNGILSKAGILKKFEEEDLDDILRKRLKDSSEIPGALWHIYAGKDVDKIREFLQKISKEQGLEVLPEHDPIRDQSWYVNKKLRQRLLEEYGVRTCTLIQFLGDAIVLPAGALHQVQNFHSCIQVTEDFVSPEHLVESFHLTQELR
Research Area Epigenetics and Nuclear Signaling
Source E.coli
Gene Names JMJD1C
Protein Names Recommended name: Probable JmjC domain-containing histone demethylation protein 2C EC= 1.14.11.- Alternative name(s): Jumonji domain-containing protein 1C Thyroid receptor-interacting protein 8 Short name= TR-interacting protein
Expression Region 2274-2498aa
Tag Info N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Mol. Weight 45.5kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
References
Still Have Questions? Leave a Message or Start an on-line Chat
Function Probable histone demethylase that specifically demethylates 'Lys-9' of histone H3, thereby playing a central role in histone code. Demethylation of Lys residue generates formaldehyde and succinate. May be involved in hormone-dependent transcriptional activation, by participating in recruitment to androgen-receptor target genes (By similarity).
Subcellular Location Nucleus
Protein Families JHDM2 histone demethylase family
Database Links

HGNC: 12313

OMIM: 604503

KEGG: hsa:221037

STRING: 9606.ENSP00000382204

UniGene: Hs.413416

Related Products

JMJD1C Antibodies

JMJD1C Antibodies for Human

JMJD1C Proteins

JMJD1C Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.