Recombinant Human Probable JmjC domain-containing histone demethylation protein 2C (JMJD1C), partial

In Stock
Code CSB-EP624030HU
Abbreviation Recombinant Human JMJD1C protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
JMJD1C
Uniprot No.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
JHD2C_HUMAN; Jmjd1c; Jumonji domain containing 1C ; Jumonji domain-containing protein 1C; Probable JmjC domain-containing histone demethylation protein 2C; Thryoid receptor interacting protein; Thyroid receptor-interacting protein 8; TR-interacting protein 8; TRIP-8; TRIP8
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
2274-2498aa
Target Protein Sequence
MPARYEDLLKSLPLPEYCNPEGKFNLASHLPGFFVRPDLGPRLCSAYGVVAAKDHDIGTTNLHIEVSDVVNILVYVGIAKGNGILSKAGILKKFEEEDLDDILRKRLKDSSEIPGALWHIYAGKDVDKIREFLQKISKEQGLEVLPEHDPIRDQSWYVNKKLRQRLLEEYGVRTCTLIQFLGDAIVLPAGALHQVQNFHSCIQVTEDFVSPEHLVESFHLTQELR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
45.5kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Probable histone demethylase that specifically demethylates 'Lys-9' of histone H3, thereby playing a central role in histone code. Demethylation of Lys residue generates formaldehyde and succinate. May be involved in hormone-dependent transcriptional activation, by participating in recruitment to androgen-receptor target genes.
Gene References into Functions
  1. Study provides evidence that SNPs of JMJD1C and KCNQ1 are prospectively associated with the risk of type 2 diabetes (T2D) in Korean population. Additionally, CDKAL1 may not be associated with T2D onset over the age of 40. PMID: 28406950
  2. JMJD1C is one of the target genes of hsa-miR-590- 3p. PMID: 27064872
  3. Our findings indicate that mutations in JMJD1C contribute to the development of Rett syndrome and intellectual disability. PMID: 26181491
  4. genetic variants in the androgen-related genes CYP17A1 and JMJD1C might be associated with risk of Barrett's esophagus (BE) and esophageal adenocarcinoma (EAC). PMID: 26414697
  5. Histone modifier genes (JMJD1C, RREB1, MINA, KDM7A) alter conotruncal heart phenotypes in 22q11.2 deletion syndrome. PMID: 26608785
  6. JMJD1C is directly recruited by RUNX1-RUNX1T1 to its target genes and regulates their expression by maintaining low H3K9 dimethyl (H3K9me2) levels PMID: 26494788
  7. Depletion of JMJD1C impairs expansion and colony formation of leukemic cell lines, with the strongest effect observed in the MLL-rearranged ALL cell line SEM. PMID: 24501218
  8. JMJD1C represses neural differentiation of hESCs at least partially by epigenetically sustaining miR-302 expression PMID: 24318875
  9. JMJD1C regulates the RAP80-BRCA1 branch of this DNA-damage response (DDR) pathway. PMID: 24240613
  10. No evidence for JMJD1C histone demethylase activity towards H3K9. PMID: 23593242
  11. Observational study of gene-disease association. (HuGE Navigator) PMID: 20648472
  12. Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator) PMID: 20379614
  13. Observational study and genome-wide association study of gene-disease association. (HuGE Navigator) PMID: 20526338
  14. TRIP8 gene codes for a protein predicted to be a transcriptional regulator associated with nuclear thyroid hormone receptors. Positional candidate gene for autism. PMID: 17290275
  15. the discovery of a new Receptors, Androgen coactivator which belongs to the JmjC containing enzyme family as a novel variant of JMJD1C PMID: 17353003
  16. Human JMJD1C variant 2 with TRI8H1, TRI8H2, and JmjC domains showed 85.7% total-amino-acid identity with mouse Jmjd1c. PMID: 17549425
  17. Observational study and genome-wide association study of gene-disease association. (HuGE Navigator) PMID: 19936222
  18. Observational study of gene-disease association. (HuGE Navigator) PMID: 16385451
  19. Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator) PMID: 18940312

Show More

Hide All

Subcellular Location
Nucleus.
Protein Families
JHDM2 histone demethylase family
Database Links

HGNC: 12313

OMIM: 604503

KEGG: hsa:221037

STRING: 9606.ENSP00000382204

UniGene: Hs.413416

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*