Recombinant Human Proheparin-binding EGF-like growth factor(HBEGF),partial

Code CSB-YP857429HU
Product Type Recombinant Protein
Size US$2959
Uniprot No. Q99075
Relevance Growth factor that mediates its effects via EGFR, ERBB2 and ERBB4. Required for normal cardiac valve formation and normal heart function. Promotes smooth muscle cell proliferation. May be involved in macrophage-mediated cellular proliferation. It is mitogenic for fibroblasts, but not endothelial cells. It is able to bind EGF receptor/EGFR with higher affinity than EGF itself and is a far more potent mitogen for smooth muscle cells than EGF. Also acts as a diphtheria toxin receptor.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence DLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSL
Research Area Cancer
Source Yeast
Gene Names HBEGF
Protein Names Diphtheria toxin receptorShort name:DT-RDTR, DTS, HEGFL
Expression Region 63-148aa
Tag Info C-terminal 6xHis-tagged
Mol. Weight 11.7 kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Growth factor that mediates its effects via EGFR, ERBB2 and ERBB4. Required for normal cardiac valve formation and normal heart function. Promotes smooth muscle cell proliferation. May be involved in macrophage-mediated cellular proliferation. It is mitogenic for fibroblasts, but not endothelial cells. It is able to bind EGF receptor/EGFR with higher affinity than EGF itself and is a far more potent mitogen for smooth muscle cells than EGF. Also acts as a diphtheria toxin receptor.
Subcellular Location Heparin-binding EGF-like growth factor: Secreted, extracellular space
Database Links

HGNC: 3059

OMIM: 126150

KEGG: hsa:1839

STRING: 9606.ENSP00000230990

UniGene: Hs.592942

Pathway ErbB signaling pathway
Estrogen signaling pathway

Related Products

HBEGF Antibodies

HBEGF Antibodies for Human

HBEGF Antibodies for Homo sapiens (Human)

HBEGF Proteins

HBEGF Proteins for Homo sapiens (Human)

HBEGF ELISA Kit

HBEGF ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.