Recombinant Human Prolactin-inducible protein(PIP)

Code CSB-YP018020HU
Product Type Recombinant Protein
Size US$2010
Uniprot No. P12273
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP018020HU could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) PIP.
  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP018020HU could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) PIP.
Storage Buffer Tris-based buffer,50% glycerol
Alias Gross cystic disease fluid protein 15
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence QDNTRKIIIKNFDIPKSVRPNDEVTAVLAVQTELKECMVVKTYLISSIPLQGAFNYKYTACLCDDNPKTFYWDFYTNRTVQIAAVVDVIRELGICPDDAAVIPIKNNRFYTIEILKVE
Research Area Signal Transduction
Source Yeast
Gene Names PIP
Protein Names Recommended name: Prolactin-inducible protein Alternative name(s): Gross cystic disease fluid protein 15 Short name= GCDFP-15 Prolactin-induced protein Secretory actin-binding protein Short name= SABP gp17
Expression Region 29-146aa
Tag Info N-terminal 10xHis-tagged
Mol. Weight 16.0kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Secreted
Protein Families PIP family
Tissue Specificity Expressed in pathological conditions of the mammary gland and in several exocrine tissues, such as the lacrimal, salivary, and sweat glands.
Database Links

HGNC: 8993

OMIM: 176720

KEGG: hsa:5304

STRING: 9606.ENSP00000291009

UniGene: Hs.99949

Related Products

PIP Antibodies

PIP Antibodies for Homo sapiens (Human)

PIP Antibodies for Human

PIP Proteins

PIP Proteins for Homo sapiens (Human)

PIP ELISA Kit

PIP ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.