Recombinant Human Prolactin-inducible protein (PIP)

In Stock
Code CSB-EP018020HU
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
PIP
Uniprot No.
Research Area
Signal Transduction
Alternative Names
BRST-2; BRST2; GCDFP-15; GCDGP15; gp17; GPIP4; Gross cystic disease fluid protein 15; PIP; PIP_HUMAN; Prolactin induced protein; Prolactin inducible protein precursor; Prolactin-induced protein; Prolactin-inducible protein; SABP; Secretory actin binding protein; Secretory actin-binding protein
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
29-146aa
Target Protein Sequence
QDNTRKIIIKNFDIPKSVRPNDEVTAVLAVQTELKECMVVKTYLISSIPLQGAFNYKYTACLCDDNPKTFYWDFYTNRTVQIAAVVDVIRELGICPDDAAVIPIKNNRFYTIEILKVE
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
17.5kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The expression region of this recombinant Human PIP covers amino acids 29-146. This PIP protein is theoretically predicted to have a molecular weight of 17.5 kDa. Expression of this PIP protein is conducted in e.coli. The PIP coding gene included the N-terminal 6xHis tag, which simplifies the detection and purification processes of the recombinant PIP protein in following stages of expression and purification.

Prolactin-inducible protein (PIP) is a member of the lipophilin subfamily within the secretoglobin superfamily. PIP is expressed by normal apocrine glands, including salivary, lacrimal, and sweat glands, and is secreted into different body fluids, including milk, saliva, and seminal fluid. PIP is regulated by hormones such as androgens and estrogens. It is highly expressed in breast cancer cells, whereas its levels are normally low in the mammary glands of healthy people. PIP modulates cell-matrix and cell-cell adhesion in breast cancer cells. It also promotes incasion and cell cycle progression of breast cancer cells. PIP expression is commonly used as a marker for certain breast cancers, particularly those with glandular differentiation. Its presence is often associated with tumors that have a more favorable prognosis.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Gene References into Functions
  1. Unusual N-type glycosylation of salivary prolactin-inducible protein (PIP): multiple Lewis(Y) epitopes generate highly-fucosylated glycan structures. PMID: 29858715
  2. that GATA3 is a very sensitive marker for primary genital extramammary Paget diseases and is more sensitive than gross cystic disease fluid protein 15 PMID: 28693610
  3. monoclonal antibodies to GATA-3 are very sensitive reagents for the identification of breast CA, surpassing antibodies to GCDFP-15 and mammaglobin A, and offer a significant improvement in identifying TNBCs PMID: 26447897
  4. good coincidence was observed between primary and metastatic tumor GATA3 expression (kappa value = 0.826 >0.75) as compared with the coincidence of GCDFP15 (kappa value =0.492 <0.75) and mammaglobin (kappa value =0.593 <0.75) PMID: 28038704
  5. High expression of GCDFP-15 is associated with molecular apocrine breast cancer. PMID: 26711786
  6. While highly expressed under pathological conditions of the mammary gland, including breast cancers, PIP is expressed in very few other cancers. Although the function of PIP is not well elucidated, numerous studies suggest that its primary role may be related to host defense and immune modulation. Studies in Pip null mice suggest that PIP may play a similar immune-regulatory role in breast cancer. [Review] PMID: 27602994
  7. novel marker GATA3 stains a significantly higher proportion of both primary and metastatic breast carcinomas than GCDFP15 or mammaglobin with stronger and more diffuse staining, helpful in cases with small tissue samples PMID: 25906123
  8. In summary, this study suggests that PIP expression regulates the process of cell adhesion in breast cancer. PMID: 26585492
  9. GCDFP15 in stratum corneum is a potential marker for dysregulated sweating in atopic dermatitis. PMID: 25919462
  10. The commonly used breast carcinoma biomarkers vary in their prognostic implications. GCDFP-15 independently indicated a favourable prognosis. GATA-3 and MGB were not associated with outcome. PMID: 25425335
  11. Data indicate the potential role of Gross cystic disease fluid protein-15/prolactin-inducible protein (GCDFP-15/PIP) as a biomarker for keratoconus (KC)disease. PMID: 25405607
  12. Prolactin-induced protein mediates cell invasion and regulates integrin signaling in estrogen receptor-negative breast cancer. PMID: 22817771
  13. GCDFP-15 expression is higher in tumors with favorable prognostic features. GCDFP-15 expression is further a frequent feature of androgen receptor positive tumors and the molecular apocrine subtype. PMID: 25070172
  14. PIP is a breast cancer-related protein that is expressed in a majority of breast tumors and has a significant function in the biology of this disease. [review] PMID: 25472539
  15. we found that HER2 or GCDFP15 protein overexpression is a sensitive and specific tool to differentiate MA from BL in the context of ER negative tumors. PMID: 23663520
  16. The roles of PIP in the related T47D breast cancer cell line, were investigated. PMID: 23755096
  17. PIP is required for cell cycle progression in breast cancer and provides a rationale for exploring PIP inhibition as a therapeutic approach in breast cancer that can potentially target microtubule polymerization. PMID: 24862759
  18. Report GCDFP15 expression in metastatic basal-like triple negative breast carcinomas. PMID: 24272937
  19. AZGP1 and PIP were found in significantly lower levels in invasive breast tissue. PMID: 24114735
  20. GCDFP-15 was associated significantly with a breast cancer profile of good prognosis tumors. PMID: 23332923
  21. Gross cystic disease fluid protein-15 and mammaglobin A expression determined by immunohistochemistry is of limited utility in triple-negative breast cancer. PMID: 22963676
  22. Interaction analysis identifies semenogelin I fragments as new binding partners of PIP in human seminal plasma PMID: 23085372
  23. GCDFP-15 alone is not a useful marker to detect the metastasis of basaloid type breast cancers. PMID: 23011826
  24. expression was down-regulated in azoospermia, indicating that PIP may be a plausible marker of azoospermia PMID: 22724438
  25. The first report of native human serum albumin (HSA)-PIP complex formation in seminal plasma. PMID: 22209935
  26. abnormal development of the prepuce in hypospadias is associated with variation in PIP expression PMID: 21883842
  27. Data suggest that Runx2 controls a positive feedback loop between androgen signaling and PIP, and pharmacological inhibition of PIP may be useful to treat PIP positive tumors. PMID: 21809344
  28. Most basal-like breast carcinomas and unclassified triple-negative carcinomas are negative for mammaglobin and gross cystic disease fluid protein 15. PMID: 21411781
  29. expressed on a small subset of primary lung adenocarcinomas PMID: 19620839
  30. Intragenic amplification and formation of extrachromosomal small circular DNA molecules from the PIP gene on chromosome 7 in primary breast carcinomas PMID: 11992405
  31. different conformations and/or tissue-specific posttranslational modifications of the proteins, although their primary structure was identical by MS/MS analysis PMID: 12755619
  32. Forms a protein complex with PIG-F and is involved in the conversion of phosphatidylinositol glycans. PMID: 15632136
  33. The sensitivity of mammaglobin is equal or superior to that of GCDFP-15 for investigation of breast carcinoma. PMID: 18251583
  34. analysis of the novel complex formed between zinc alpha2-glycoprotein (ZAG) and prolactin-inducible protein (PIP) from human seminal plasma PMID: 18930737
  35. Both MGB1 and GCDFP-15 are specific markers for metastatic breast carcinomas in cell block fluid specimens (88 vs. 96%). PMID: 19217055
  36. importance of a regulatory subnetwork associated with PIP expression in which STAT5 appears as a potential transcriptional regulator PMID: 19262752
  37. PIP(alternate name GCDFP-15, gp17) is a secretory marker of apocrine differentiation in breast carcinoma. It is an aspartyl proteinase with specificity restricted for fibronectin. PMID: 10713110

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
PIP family
Tissue Specificity
Expressed in pathological conditions of the mammary gland and in several exocrine tissues, such as the lacrimal, salivary, and sweat glands.
Database Links

HGNC: 8993

OMIM: 176720

KEGG: hsa:5304

STRING: 9606.ENSP00000291009

UniGene: Hs.99949

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
webinars: DT3C facilitates antibody internalization X
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*