Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Signal Transduction
Alternative Names
BRST-2; BRST2; GCDFP-15; GCDGP15; gp17; GPIP4; Gross cystic disease fluid protein 15; PIP; PIP_HUMAN; Prolactin induced protein; Prolactin inducible protein precursor; Prolactin-induced protein; Prolactin-inducible protein; SABP; Secretory actin binding protein; Secretory actin-binding protein
Species
Homo sapiens (Human)
Expression Region
29-146aa
Target Protein Sequence
QDNTRKIIIKNFDIPKSVRPNDEVTAVLAVQTELKECMVVKTYLISSIPLQGAFNYKYTACLCDDNPKTFYWDFYTNRTVQIAAVVDVIRELGICPDDAAVIPIKNNRFYTIEILKVE
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The expression region of this recombinant Human PIP covers amino acids 29-146. This PIP protein is theoretically predicted to have a molecular weight of 17.5 kDa. Expression of this PIP protein is conducted in e.coli. The PIP coding gene included the N-terminal 6xHis tag, which simplifies the detection and purification processes of the recombinant PIP protein in following stages of expression and purification.
Prolactin-inducible protein (PIP) is a member of the lipophilin subfamily within the secretoglobin superfamily. PIP is expressed by normal apocrine glands, including salivary, lacrimal, and sweat glands, and is secreted into different body fluids, including milk, saliva, and seminal fluid. PIP is regulated by hormones such as androgens and estrogens. It is highly expressed in breast cancer cells, whereas its levels are normally low in the mammary glands of healthy people. PIP modulates cell-matrix and cell-cell adhesion in breast cancer cells. It also promotes incasion and cell cycle progression of breast cancer cells. PIP expression is commonly used as a marker for certain breast cancers, particularly those with glandular differentiation. Its presence is often associated with tumors that have a more favorable prognosis.