Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

PIP

Uniprot No.

P12273

Research Area

Signal Transduction

Alternative Names

BRST-2; BRST2; GCDFP-15; GCDGP15; gp17; GPIP4; Gross cystic disease fluid protein 15; PIP; PIP_HUMAN; Prolactin induced protein; Prolactin inducible protein precursor; Prolactin-induced protein; Prolactin-inducible protein; SABP; Secretory actin binding protein; Secretory actin-binding protein

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

29-146aa

Target Protein Sequence

QDNTRKIIIKNFDIPKSVRPNDEVTAVLAVQTELKECMVVKTYLISSIPLQGAFNYKYTACLCDDNPKTFYWDFYTNRTVQIAAVVDVIRELGICPDDAAVIPIKNNRFYTIEILKVE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

17.5kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The expression region of this recombinant Human PIP covers amino acids 29-146. This PIP protein is theoretically predicted to have a molecular weight of 17.5 kDa. Expression of this PIP protein is conducted in e.coli. The PIP coding gene included the N-terminal 6xHis tag, which simplifies the detection and purification processes of the recombinant PIP protein in following stages of expression and purification.

Prolactin-inducible protein (PIP) is a member of the lipophilin subfamily within the secretoglobin superfamily. PIP is expressed by normal apocrine glands, including salivary, lacrimal, and sweat glands, and is secreted into different body fluids, including milk, saliva, and seminal fluid. PIP is regulated by hormones such as androgens and estrogens. It is highly expressed in breast cancer cells, whereas its levels are normally low in the mammary glands of healthy people. PIP modulates cell-matrix and cell-cell adhesion in breast cancer cells. It also promotes incasion and cell cycle progression of breast cancer cells. PIP expression is commonly used as a marker for certain breast cancers, particularly those with glandular differentiation. Its presence is often associated with tumors that have a more favorable prognosis.

Target Background

Gene References into Functions

Unusual N-type glycosylation of salivary prolactin-inducible protein (PIP): multiple Lewis(Y) epitopes generate highly-fucosylated glycan structures. PMID: 29858715
that GATA3 is a very sensitive marker for primary genital extramammary Paget diseases and is more sensitive than gross cystic disease fluid protein 15 PMID: 28693610
monoclonal antibodies to GATA-3 are very sensitive reagents for the identification of breast CA, surpassing antibodies to GCDFP-15 and mammaglobin A, and offer a significant improvement in identifying TNBCs PMID: 26447897
good coincidence was observed between primary and metastatic tumor GATA3 expression (kappa value = 0.826 >0.75) as compared with the coincidence of GCDFP15 (kappa value =0.492 <0.75) and mammaglobin (kappa value =0.593 <0.75) PMID: 28038704
High expression of GCDFP-15 is associated with molecular apocrine breast cancer. PMID: 26711786
While highly expressed under pathological conditions of the mammary gland, including breast cancers, PIP is expressed in very few other cancers. Although the function of PIP is not well elucidated, numerous studies suggest that its primary role may be related to host defense and immune modulation. Studies in Pip null mice suggest that PIP may play a similar immune-regulatory role in breast cancer. [Review] PMID: 27602994
novel marker GATA3 stains a significantly higher proportion of both primary and metastatic breast carcinomas than GCDFP15 or mammaglobin with stronger and more diffuse staining, helpful in cases with small tissue samples PMID: 25906123
In summary, this study suggests that PIP expression regulates the process of cell adhesion in breast cancer. PMID: 26585492
GCDFP15 in stratum corneum is a potential marker for dysregulated sweating in atopic dermatitis. PMID: 25919462
The commonly used breast carcinoma biomarkers vary in their prognostic implications. GCDFP-15 independently indicated a favourable prognosis. GATA-3 and MGB were not associated with outcome. PMID: 25425335
Data indicate the potential role of Gross cystic disease fluid protein-15/prolactin-inducible protein (GCDFP-15/PIP) as a biomarker for keratoconus (KC)disease. PMID: 25405607
Prolactin-induced protein mediates cell invasion and regulates integrin signaling in estrogen receptor-negative breast cancer. PMID: 22817771
GCDFP-15 expression is higher in tumors with favorable prognostic features. GCDFP-15 expression is further a frequent feature of androgen receptor positive tumors and the molecular apocrine subtype. PMID: 25070172
PIP is a breast cancer-related protein that is expressed in a majority of breast tumors and has a significant function in the biology of this disease. [review] PMID: 25472539
we found that HER2 or GCDFP15 protein overexpression is a sensitive and specific tool to differentiate MA from BL in the context of ER negative tumors. PMID: 23663520
The roles of PIP in the related T47D breast cancer cell line, were investigated. PMID: 23755096
PIP is required for cell cycle progression in breast cancer and provides a rationale for exploring PIP inhibition as a therapeutic approach in breast cancer that can potentially target microtubule polymerization. PMID: 24862759
Report GCDFP15 expression in metastatic basal-like triple negative breast carcinomas. PMID: 24272937
AZGP1 and PIP were found in significantly lower levels in invasive breast tissue. PMID: 24114735
GCDFP-15 was associated significantly with a breast cancer profile of good prognosis tumors. PMID: 23332923
Gross cystic disease fluid protein-15 and mammaglobin A expression determined by immunohistochemistry is of limited utility in triple-negative breast cancer. PMID: 22963676
Interaction analysis identifies semenogelin I fragments as new binding partners of PIP in human seminal plasma PMID: 23085372
GCDFP-15 alone is not a useful marker to detect the metastasis of basaloid type breast cancers. PMID: 23011826
expression was down-regulated in azoospermia, indicating that PIP may be a plausible marker of azoospermia PMID: 22724438
The first report of native human serum albumin (HSA)-PIP complex formation in seminal plasma. PMID: 22209935
abnormal development of the prepuce in hypospadias is associated with variation in PIP expression PMID: 21883842
Data suggest that Runx2 controls a positive feedback loop between androgen signaling and PIP, and pharmacological inhibition of PIP may be useful to treat PIP positive tumors. PMID: 21809344
Most basal-like breast carcinomas and unclassified triple-negative carcinomas are negative for mammaglobin and gross cystic disease fluid protein 15. PMID: 21411781
expressed on a small subset of primary lung adenocarcinomas PMID: 19620839
Intragenic amplification and formation of extrachromosomal small circular DNA molecules from the PIP gene on chromosome 7 in primary breast carcinomas PMID: 11992405
different conformations and/or tissue-specific posttranslational modifications of the proteins, although their primary structure was identical by MS/MS analysis PMID: 12755619
Forms a protein complex with PIG-F and is involved in the conversion of phosphatidylinositol glycans. PMID: 15632136
The sensitivity of mammaglobin is equal or superior to that of GCDFP-15 for investigation of breast carcinoma. PMID: 18251583
analysis of the novel complex formed between zinc alpha2-glycoprotein (ZAG) and prolactin-inducible protein (PIP) from human seminal plasma PMID: 18930737
Both MGB1 and GCDFP-15 are specific markers for metastatic breast carcinomas in cell block fluid specimens (88 vs. 96%). PMID: 19217055
importance of a regulatory subnetwork associated with PIP expression in which STAT5 appears as a potential transcriptional regulator PMID: 19262752
PIP(alternate name GCDFP-15, gp17) is a secretory marker of apocrine differentiation in breast carcinoma. It is an aspartyl proteinase with specificity restricted for fibronectin. PMID: 10713110

Hide All

Subcellular Location

Secreted.

Protein Families

PIP family

Tissue Specificity

Expressed in pathological conditions of the mammary gland and in several exocrine tissues, such as the lacrimal, salivary, and sweat glands.

Database Links

HGNC: 8993

OMIM: 176720

KEGG: hsa:5304

STRING: 9606.ENSP00000291009

UniGene: Hs.99949

Code	CSB-EP018020HU
Abbreviation	Recombinant Human PIP protein
MSDS	MSDS Datasheet
Size	$224
	Order now
Image	Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Prolactin-inducible protein (PIP)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage