Recombinant Human Promotilin (MLN)

In Stock
Code CSB-EP014638HU
Abbreviation Recombinant Human MLN protein
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
MLN
Uniprot No.
Research Area
Signal Transduction
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
26-115aa
Target Protein Sequence
FVPIFTYGELQRMQEKERNKGQKKSLSVWQRSGEEGPVDPAEPIREEENEMIKLTAPLEIGMRMNSRQLEKYPATLEGLLSEMLPQHAAK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
45.5 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Plays an important role in the regulation of interdigestive gastrointestinal motility and indirectly causes rhythmic contraction of duodenal and colonic smooth muscle.
Gene References into Functions
  1. Hemodialysis improves upper GI symptoms and gastric slow waves in CKD patients. An increase in ghrelin and a decrease in GLP-1 might be involved in the HD-induced improvement in gastric slow waves. PMID: 28566304
  2. motilin-induced phase III contractions signal hunger in healthy subjects and that this system is disturbed in morbidly obese patients--{REVIEW} PMID: 26660537
  3. Motilin stimulates growth hormone secretion and regulates interdigestive migrating contractions and fasting motor patterns in the gastrointestinal tract. [REVIEW] PMID: 22632857
  4. Motilin may directly influence adipocyte functions by stimulating energy storage. PMID: 21771971
  5. Ghrelin covaried with motilin in plasma in irritable bowel syndrome (IBS) but not in plasma from healthy subjects. This suggests the two peptides act together in IBS. PMID: 20338210
  6. Plasma levels of motilin were studied in 16 untreated Celiac disease patients and in an age-matched control group of 18 healthy subjects by radioimmunoassay and by high-performance liquid chromatography (HPLC). PMID: 12732349
  7. Ghrelin and motilin are cosecreted from a prominent endocrine cell population in the small intestine. PMID: 17595255
  8. The abnormal excretion of hormonal factors is closely related to gallstone formation PMID: 18234640
  9. About 35.9% of the patients with a T tube after cholecystectomy and choledochotomy have duodenal-biliary reflux. Most of them have sphincter of Oddi hypomotility and the decreased level of plasma motilin and serum gastrin. PMID: 18609694

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Motilin family
Database Links

HGNC: 7141

OMIM: 158270

KEGG: hsa:4295

STRING: 9606.ENSP00000388825

UniGene: Hs.2813

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*