Recombinant Human Proteasome subunit beta type-10(PSMB10)

Code CSB-EP018877HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. P40306
Relevance The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. This subunit is involved in antigen processing to generate class I binding peptides.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Low molecular mass protein 10 Macropain subunit MECl-1 Multicatalytic endopeptidase complex subunit MECl-1 Proteasome MECl-1 Proteasome subunit beta-2i
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MLKPALEPRGGFSFENCQRNASLERVLPGLKVPHARKTGTTIAGLVFQDGVILGADTRATNDSVVADKSCEKIHFIAPKIYCCGAGVAADAEMTTRMVASKMELHALSTGREPRVATVTRILRQTLFRYQGHVGASLIVGGVDLTGPQLYGVHPHGSYSRLPFTALGSGQDAALAVLEDRFQPNMTLEAAQGLLVEAVTAGILGDLGSGGNVDACVITKTGAKLLRTLSSPTEPVKRSGRYHFVPGTTAVLTQTVKPLTLELVEETVQAMEVE
Research Area Immunology
Source E.coli
Gene Names PSMB10
Protein Names Recommended name: Proteasome subunit beta type-10 EC= 3.4.25.1Alternative name(s): Low molecular mass protein 10 Macropain subunit MECl-1 Multicatalytic endopeptidase complex subunit MECl-1 Proteasome MECl-1 Proteasome subunit beta
Expression Region 1-273aa
Tag Info N-terminal GST-tagged
Mol. Weight 51.6kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. This subunit is involved in antigen processing to generate class I binding peptides.
Subcellular Location Cytoplasm, Nucleus
Protein Families Peptidase T1B family
Database Links

HGNC: 9538

OMIM: 176847

KEGG: hsa:5699

STRING: 9606.ENSP00000351314

UniGene: Hs.9661

Related Products

PSMB10 Antibodies

PSMB10 Antibodies for Homo sapiens (Human)

PSMB10 Antibodies for Human

PSMB10 Proteins

PSMB10 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.