Recombinant Human Proteasome subunit beta type-10(PSMB10)

Code CSB-EP018877HU
Size US$1726
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names PSMB10
Uniprot No. P40306
Research Area Immunology
Alternative Names beta2i; FLJ00366; LMP10; Low molecular mass protein 10; Macropain subunit MECl 1; Macropain subunit MECl-1; MECL1; MGC1665; Multicatalytic endopeptidase complex subunit MECl 1; Multicatalytic endopeptidase complex subunit MECl-1; OTTHUMP00000174858; Proteasome (prosome macropain) subunit beta type 10; Proteasome beta 10 subunit; Proteasome catalytic subunit 2i; Proteasome MECl 1; Proteasome MECl-1; Proteasome subunit beta 2i; Proteasome subunit beta 7i; Proteasome subunit beta type 10; Proteasome subunit beta type-10; Proteasome subunit beta-2i; Proteasome subunit MECL1; PSB10_HUMAN; PSMB 10; Psmb10
Species Homo sapiens (Human)
Source E.coli
Expression Region 1-273aa
Target Protein Sequence MLKPALEPRGGFSFENCQRNASLERVLPGLKVPHARKTGTTIAGLVFQDGVILGADTRATNDSVVADKSCEKIHFIAPKIYCCGAGVAADAEMTTRMVASKMELHALSTGREPRVATVTRILRQTLFRYQGHVGASLIVGGVDLTGPQLYGVHPHGSYSRLPFTALGSGQDAALAVLEDRFQPNMTLEAAQGLLVEAVTAGILGDLGSGGNVDACVITKTGAKLLRTLSSPTEPVKRSGRYHFVPGTTAVLTQTVKPLTLELVEETVQAMEVE
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 51.6kDa
Protein Length Full Length
Tag Info N-terminal GST-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. This subunit is involved in antigen processing to generate class I binding peptides.
Gene References into Functions
  1. this study provided novel evidence demonstrating that LMP10 is a positive regulator of NF-kB signaling, which contributes to Ang II-induced retinopathy. PMID: 29499566
  2. LMP10 nuclear expression in the Human Papillomavirus (HPV)-positive group and LMP10 cytoplasmic expression in the HPV-negative group of patients correlated to better clinical outcome. PMID: 24752327
  3. Adenovirus E1A causes down-regulation of MECL1 expression PMID: 22018786
  4. Multicatalytic endopeptidase complex subunit is involved in antigen presentation and is an important candidate gene for initial exploration of relationships between antigen processing genes and disease resistance. PMID: 17541830
Subcellular Location Cytoplasm, Nucleus
Protein Families Peptidase T1B family
Database Links

HGNC: 9538

OMIM: 176847

KEGG: hsa:5699

STRING: 9606.ENSP00000351314

UniGene: Hs.9661

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1