Recombinant Human Protein AMBP (AMBP), partial

Code CSB-YP001654HU
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP001654HU
MSDS
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP001654HU-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP001654HU
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP001654HU
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥85% (SDS-PAGE)
Target Names
AMBP
Uniprot No.
Alternative Names
Protein AMBP; Protein HC; [Cleaved into: Alpha-1-microglobulin; EC 1.6.2.-; Alpha-1 microglycoprotein; Complex-forming glycoprotein heterogeneous in charge; Inter-alpha-trypsin inhibitor light chain; ITI-LC; Bikunin; EDC1; HI-30; Uronic-acid-rich protein; Trypstatin] AMBP HCP ITIL
Species
Homo sapiens (Human)
Expression Region
20-203
Target Protein Sequence
GPVPTPPDNIQVQENFNISRIYGKWYNLAIGSTCPWLKKIMDRMTVSTLVLGEGATEAEISMTSTRWRKGVCEETSGAYEKTDTDGKFLYHKSKWNITMESYVVHTNYDEYAIFLTKKFSRHHGPTITAKLYGRAPQLRETLLQDFRVVAQGVGIPEDSIFTMADRGECVPGEQEPEPILIPRV
Protein Length
Partial
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Inter-alpha-trypsin inhibitor inhibits trypsin, plasmin, and lysosomal granulocytic elastase. Inhibits calcium oxalate crystallization.; Trypstatin is a trypsin inhibitor.
Gene References into Functions
  1. There were significantly higher serum concentrations of fetal hemoglobin and alpha1-microglobulin and significantly lower first trimester serum concentrations of hemopexin in patients who later developed preeclampsia. PMID: 27155336
  2. Prophylactic UTI maintains the endothelial barrier function, increases VE-cadherin expression, and inhibits the phosphorylation of VE-cadherin at Tyr658 under inflammatory conditions PMID: 26681130
  3. Data suggest that Mg2+ or Mn2+ (but not Ca2+) induce a conformational change in inter-alpha-inhibitor (ITIH1 and ITIH2) and a bikunin/chondroitin sulfate-dependent increase in thermodynamic stability; bikunin binds adjacent to the two heavy chains. PMID: 26728454
  4. Data indicate that two heme groups can be bound simultaneously at separate sites in the antioxidant alpha1-microglobulin. PMID: 26497278
  5. results indicate a reduced UTI level in CSF of MS and NMO patients. The levels were associated with the severity of the two demyelinating diseases during relapse PMID: 25555815
  6. Proximal tubular dysfunction, indicated by urine alpha1-microglobulin, was independently associated with kidney function decline in HIV-infected and uninfected women and mortality risk among HIV-infected women. PMID: 25370597
  7. placental alpha microglobulin-1 is a sensitive and specific test to assess rupture of membranes in patients with an equivocal diagnosis based on simple tests PMID: 24698819
  8. Heavy chain transfer by tumor necrosis factor-stimulated gene 6 to the bikunin proteoglycan. PMID: 25561734
  9. Decreased bikunin mRNA level in renal cells might be associated with poor prognosis of renal carcinoma. PMID: 24980765
  10. The antioxidative protection of cells and collagen by A1M is totally dependent on its C34 amino acid residue. PMID: 23642167
  11. Label-free quantitative comparison of DN urinary exosomes vs control group and SRM further validation, resulted in the discovery of a panel of three proteins (AMBP, MLL3 and VDAC1) which changes in DN. PMID: 24211404
  12. The high level of serum AMBP could predict the poor response of the AGC patients. PMID: 24135868
  13. In pre-term pregnant women with intact membranes, placental alpha-microglobulin-1 in cervicovaginal fluid test rates are more positive in cases of uterine contraction. PMID: 23919851
  14. our findings suggest that urine bikunin level, as well as proteinuria, could represent a useful parameter for monitoring renal function in those patients that do not present any symptoms of renal insufficiency. PMID: 23841057
  15. Determined is the first structure of human alpha-1-microglobulin with heavy electron density of the chromophore. PMID: 24012674
  16. Sulfation of the bikunin chondroitin sulfate chain determines heavy chain.hyaluronan complex formation PMID: 23801333
  17. High urine alpha-1-microglobulin is associated with interstitial fibrosis and tubular atrophy plus inflammation. PMID: 23414180
  18. High urine alpha-1-microglobulin is associated with ischemic acute tubular necrosis than other causes of acute kidney injury. PMID: 23324582
  19. Report prognostic value of urinary alpha 1-macroglobulin in idiopathic membranous nephropathy. PMID: 22595828
  20. crystal of alpha1-microglobulin belonged to space group P4(3), with unit-cell parameters a = b = 36.45, c = 112.68 A PMID: 22684072
  21. The results suggest that A1M may have a physiological role in protection of skin cells and matrix against oxidative damage following bleeding. PMID: 22096585
  22. urinary marker for the differential diagnosis of Balkan endemic nephropathy PMID: 21332340
  23. These findings suggest that there was no significant association in genotype distribution of Init-2 polymorphism of the AMBP gene between patients with kidney stones and healthy controls. PMID: 20602574
  24. the cell-protective effects of alpha(1)-microglobulin during alpha-particle irradiation PMID: 20954860
  25. The promoter of AMBP gene had polymorphisms at positions -218 and -189 nt giving three different genotypes with no association between these observed genotypes and kidney stone-forming phenotypes. PMID: 20602574
  26. increased protein levels in preeclamptic women PMID: 19879940
  27. significant relationship was established between the low level and absence of bikunin, and pro-u-PA in urine samples from patients with bladder tumors; identified bikunin loss in urine as a potential bladder carcinoma marker PMID: 19914646
  28. Transfection into H460M Human large cell lung carcinoma line decreased tumor growth and metastasis in nude mice PMID: 11807786
  29. Processing of the lipocalin alpha(1)-microglobulin by hemoglobin induces heme-binding and heme-degradation properties. PMID: 11877257
  30. bikunin has a role in downregulating PI3 kinase and suppressing tumor invasiveness and metastasis in ovaran cancer cells PMID: 14597629
  31. Data show that alpha(1) -microglobulin/bikunin precursor specifically interacts with the ORF3 protein of hepatitis E virus and has a direct role in enhancing alpha(1)microglobulin export from the hepatocyte. PMID: 15037615
  32. alpha-1-microglobulin is covalently bound to kynurenine-derived chromophores PMID: 15452109
  33. Bikunin neither decreased expression of TGF-beta receptors (TbetaRI and TbetaRII) in cancer cells nor altered the specific binding of 125I TGF-beta1 to the cells. PMID: 15498571
  34. The TSG-6 and inter-alpha-inhibitor interaction promotes a transesterification cleaving the protein-glycosaminoglycan-protein (PGP) cross-link. PMID: 15653696
  35. the second processed protein from AMBP, bikunin, strongly interacted with the full-length hepatitis E virus ORF3 protein PMID: 16140784
  36. the ORF3 protein exploits the endosomal sorting machinery to enhance the secretion of an immunosuppressant molecule (alpha1 microglobulin) from cultured hepatocytes PMID: 16407257
  37. Identification of the protein bikunin as an endogenous, competitive inhibitor of a dynorphin-converting enzyme in human cerebrospinal fluid. PMID: 17087727
  38. Free uristatin and bikunin pass readily into urine and are primarily bound to heavy chains that constitute the proinhibitor form in plasma. PMID: 17115277
  39. Bikunin was found to localize on the cell membrane, while tryptase was in the secretary granules of the mast cells from psoriatic lesions. PMID: 17146627
  40. alpha(1)-microglobulin participates in the defense against oxidation by hemoglobin, heme, and reactive oxygen species PMID: 17320766
  41. small angle X-ray scanning study of the monomer and dimer forms of alpha1-microglobulin; monomer is characterised by a radius of gyration R(G)= 2.20 nm and D(max)=6.3 nm and the dimer by R(G)=2.99 nm and D(max)=9.5 nm PMID: 17584166
  42. The ability of alpha-1-microglobulin to restore the initial conformation characteristic for the native protein and the internal dynamics after the unfolding of the globule by 10 M urea and 6 M guanidine hydrochloride has been ascertained. PMID: 17633530
  43. AMBP has radical scavenging activity. PMID: 17766242
  44. urinary trypsin inhibitor is insufficiently produced for neutrophil elastase release after cardiac arrest PMID: 17998887
  45. in multiple myeloma patients without renal failure, elevated Alpha-1-microglobulin excretion might be an early marker of renal tubular involvement PMID: 18046670
  46. In the present study, structural motifs regulating bikunin's anti-inflammatory function are delineated. Binding of bikunin to neutrophils is critically important for its anti-inflammatory capacity. PMID: 18226914
  47. The transfer of heavy chains from bikunin proteins to hyaluronan requires both TSG-6 and HC2. PMID: 18448433
  48. Overexpression of bikunin reduced the gene expression of matriptase, which attenuated in vitro cell invasion in prostate cancer. PMID: 18649735
  49. Overexpression of Urinary trypsin inhibitor is associated with recurrence in hepatocellular carcinoma. PMID: 19636634

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Calycin superfamily, Lipocalin family
Tissue Specificity
Expressed by the liver and secreted in plasma. Alpha-1-microglobulin occurs in many physiological fluids including plasma, urine, and cerebrospinal fluid. Inter-alpha-trypsin inhibitor is present in plasma and urine.
Database Links

HGNC: 453

OMIM: 176870

KEGG: hsa:259

STRING: 9606.ENSP00000265132

UniGene: Hs.436911

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1