Recombinant Human Protein CBFA2T1 (RUNX1T1)

Code CSB-EP726765HUc7
Abbreviation Recombinant Human RUNX1T1 protein
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
RUNX1T1
Uniprot No.
Research Area
Cancer
Alternative Names
Cyclin-D-related protein;Eight twenty one protein;Protein ETO;Protein MTG8;Zinc finger MYND domain-containing protein 2
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-604aa
Target Protein Sequence
MISVKRNTWRALSLVIGDCRKKGNFEYCQDRTEKHSTMPDSPVDVKTQSRLTPPTMPPPPTTQGAPRTSSFTPTTLTNGTSHSPTALNGAPSPPNGFSNGPSSSSSSSLANQQLPPACGARQLSKLKRFLTTLQQFGNDISPEIGERVRTLVLGLVNSTLTIEEFHSKLQEATNFPLRPFVIPFLKANLPLLQRELLHCARLAKQNPAQYLAQHEQLLLDASTTSPVDSSELLLDVNENGKRRTPDRTKENGFDREPLHSEHPSKRPCTISPGQRYSPNNGLSYQPNGLPHPTPPPPQHYRLDDMAIAHHYRDSYRHPSHRDLRDRNRPMGLHGTRQEEMIDHRLTDREWAEEWKHLDHLLNCIMDMVEKTRRSLTVLRRCQEADREELNYWIRRYSDAEDLKKGGGSSSSHSRQQSPVNPDPVALDAHREFLHRPASGYVPEEIWKKAEEAVNEVKRQAMTELQKAVSEAERKAHDMITTERAKMERTVAEAKRQAAEDALAVINQQEDSSESCWNCGRKASETCSGCNTARYCGSFCQHKDWEKHHHICGQTLQAQQQGDTPAVSSSVTPNSGAGSPMDTPPAATPRSTTPGTPSTIETTPR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
74.5 kDa
Protein Length
Full Length
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Transcriptional corepressor which facilitates transcriptional repression via its association with DNA-binding transcription factors and recruitment of other corepressors and histone-modifying enzymes. Can repress the expression of MMP7 in a ZBTB33-dependent manner. Can repress transactivation mediated by TCF12. Acts as a negative regulator of adipogenesis. The AML1-MTG8/ETO fusion protein frequently found in leukemic cells is involved in leukemogenesis and contributes to hematopoietic stem/progenitor cell self-renewal.
Gene References into Functions
  1. RUNX1-RUNX1T1 transcript levels were measured in bone marrow samples collected from 208 patients at scheduled time points after transplantation. Over 90% of the 175 patients who were in continuous complete remission had a >/=3-log reduction in RUNX1-RUNX1T1 transcript levels from the time of diagnosis at each time point after transplantation and a >/=4-log reduction at >/=12 months. PMID: 28166825
  2. The data suggest that the tumor suppressor activity of both RUNX1t1 and TFF1 are mechanistically connected to CEBPB and that cross-regulation between CEBPB-RUNX1t1-TFF1 plays an important role in gastric carcinogenesis. PMID: 27522676
  3. The role of RUNX1T1 in t(8;21) acute myeloid leukemia and miRNA expression regulation PMID: 28322996
  4. Our data revealed a novel role for RUNX1T1 as a tumor-suppressor gene in colorectal cancer through modulation of multiple cellular pathways affecting the cell cycle, DNA damage, DNA replication, estrogen signaling, and drug resistance PMID: 27798886
  5. A substantial fraction of AML1-ETO/p300 co-localization occurs near TSSs in promoter regions associated with transcriptionally active loci. PMID: 25928846
  6. A reduction in KIT mRNA levels was also observed in AE-silenced cells, but silencing KIT expression reduced cell growth but did not induce apoptosis. PMID: 24727677
  7. RUNX1T1 gene may participate in t(8;21)(q22;q22)-dependent leukemic transformation due to its multiple interactions in cell regulatory network particularly through synergistic or antagonistic effects in relation to activity of RUNX1-RUNX1T1 fusion gene. PMID: 24976338
  8. Runx1t1 epigenetically regulates the proliferation and nitric oxide production of microglia. PMID: 24586690
  9. The cooperative effect of the expression of mutated KIT and AML1-ETO oncogenes is crucial for selective toxic action of binase on malignant cells. PMID: 22101339
  10. RUNX1T1 point mutation may be rare and passenger mutations in acute leukemias, lung and breast cancers PMID: 21571369
  11. SMAD4 knockdown accelerated this re-silencing process, suggesting that normal TGF-beta signaling is essential for the maintenance of RunX1T1 expression PMID: 21540640
  12. Data show that low RUNX1T1 expression was highly associated with hepatic metastases. PMID: 21499216
  13. Elevated levels of AES mRNA and protein were confirmed in AML1/ETO-expressing leukemia cells, as well as in other acute myeloid leukemia specimens. PMID: 21245488
  14. ETO nervy homology region (NHR) 3 domain-PKA(RIIalpha) protein interaction does not appear to significantly contribute to AML1-ETO's ability to induce leukemia. PMID: 20708017
  15. The critical role for an evolutionary conserved GATA binding site in transcriptional regulation of the ETO gene in cells of erythroid/megakaryocytic potential. PMID: 20487545
  16. NHR4 domain mutations of ETO are probably very infrequent in AML1-ETO positive myeloid leukemia cells. PMID: 20090777
  17. no conclusive evidence as yet that the AML1/ETO chimeric gene is sufficient per se to induce leukemia. PMID: 11869944
  18. Analysis of nuclear distribution of the AML1/ETO protein and its homology domains led to identification of domains in ETO responsible for intranuclear transport and subnuclear distribution of AML1/ETO. PMID: 11983111
  19. 2 independent subnuclear targeting signals in the N- and C-terminal regions of ETO direct ETO to the same binding sites occupied by AML1ETO. This provides a molecular basis for aberrant subnuclear targeting of AML1ETO, the defect in t(8;21)-related AML. PMID: 12427969
  20. ETO rearrangements leading to the AML1-ETO fusion gene are frequently the result of small hidden interstitial insertions. PMID: 12557226
  21. Data identify ETO as a partner for Gfi-1 and Gfi-1B, and suggest that Gfi-1 proteins repress transcription through recruitment of histone deacetylase-containing complexes. PMID: 12874834
  22. ETO is a bona fide corepressor that links the transcriptional pathogenesis of acute leukemias and B-cell lymphomas and offers a compelling target for transcriptional therapy of hematologic malignancies. PMID: 14551142
  23. RT-PCR for the detection of AML1/ETO in children with acute non-lymphoid leukemia (ANLL) was quick, convenient and sensitive, and could be regarded as a useful method for the diagnosis and prognosis of ANLL. PMID: 14751048
  24. cloning, expression, purification and crystallization of NHR3 domain PMID: 15295650
  25. These findings suggest a central role of RUNX1-CBFA2T1 in the maintenance of the leukaemia. PMID: 15298716
  26. N-CoR utilizes repression domains I and III for interaction and co-repression with ETO PMID: 15377655
  27. DiffeRential expression of the ETO homologues suggests that they may have a potential role in hematopoietic differentiation. PMID: 15676213
  28. Alternative splicing in the AML1-MTG8 fusion gene occurs in leukemia cell lines as well as in cells of leukemia paatients with a(8;21) translocation. PMID: 15723339
  29. Translocations in acute myeloid leukemia (AML) is the t(8;21) is characterized by AML1-MTG8 (ETO) mutation. PMID: 16502583
  30. AML1T1, an alternatively spliced isoform of the t(8;21) transcript, promotes leukemogenesis. PMID: 16892037
  31. The leukemia-associated fusion protein AML1-ETO could aberrantly transactivate the EEN gene through an AML1 binding site. PMID: 16990610
  32. As a result, we identified 14 unique proteins deregulated in AML1-ETO-carrying leukemic cells, including 3 up-regulated such as hairy and enhancer of split 5 (HES5) and 11 down-regulated such as MAT1 (menage a trois-1. PMID: 17058450
  33. AML1/ETO participates in a protein complex with the RA receptor alpha (RARalpha) at RA regulatory regions on RARbeta2. PMID: 17244680
  34. Loss of p21(WAF1) facilitates AML1-ETO-induced leukemogenesis. PMID: 17284535
  35. Isoform AML1/ETO9a was correlated to acute myeloid leukemia-M2 subtype. PMID: 17649722
  36. Our study suggests that KIT activating mutations in AML with t(8; 21) are associated with diminished CD 19 and positive CD56 expression on leukemic blasts and, thus, can be phenotypically distinguished from AML1-ETO leukemias PMID: 17875504
  37. MTG8/ETO and Mtg16 (ETO2) associated with TCF4 PMID: 18039847
  38. These results demonstrate that scl is an important mediator of the ability of AML1-ETO to reprogram hematopoietic cell fate decisions, suggesting that scl may be an important contributor to AML1-ETO-associated leukemia. PMID: 18156164
  39. The interaction between SIN3B and ETO required an intact amino-terminus of ETO and the NHR2 domain. PMID: 18205948
  40. Knockdown of TLE1 or TLE4 levels increased the rate of cell division of the AML1-ETO-expressing Kasumi-1 cell line, whereas forced expression of either TLE1 or TLE4 caused apoptosis and cell death. PMID: 18258796
  41. ETO family member-mediated oligomerization and repression can be distinct events and that interaction between ETO family members and hSIN3B or N-CoR may not necessarily strengthen transcriptional repression. PMID: 18586123
  42. the crucial role of the NHR4 domain in determination of cellular fate during AML1-ETO-associated leukemogenesis. PMID: 18952841
  43. a major role for the functional interaction of AML1/ETO with AML1 and HEB in transcriptional regulation determined by the fusion protein. PMID: 19043539
  44. Four copies of RUNX1T1 were found. PMID: 19100510
  45. Data show that E proteins contain another conserved ETO-interacting region, termed DES, and that differential associations with AD1 and DES allow ETO to repress transcription through both chromatin-dependent and chromatin-independent mechanisms. PMID: 19289505

Show More

Hide All

Involvement in disease
A chromosomal aberration involving RUNX1T1 is a cause of acute myeloid leukemia (AML-M2). Translocation t(8;21)(q22;q22) with RUNX1/AML1.
Subcellular Location
Nucleus. Note=Colocalizes with ATN1 in discrete nuclear dots.
Protein Families
CBFA2T family
Tissue Specificity
Most abundantly expressed in brain. Lower levels in lung, heart, testis and ovary.
Database Links

HGNC: 1535

OMIM: 133435

KEGG: hsa:862

STRING: 9606.ENSP00000402257

UniGene: Hs.368431

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*