Recombinant Human Protein S100-A12 (S100A12)

In Stock
Code CSB-EP020626HU
Abbreviation Recombinant Human S100A12 protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
S100A12
Uniprot No.
Research Area
Immunology
Alternative Names
CAAF1; CAGC; Calcitermin; Calcium-binding protein in amniotic fluid 1; Calgranulin C; Calgranulin-C; Calgranulin-related protein; CGRP; EN RAGE; EN-RAGE; ENRAGE; Extracellular newly identified RAGE-binding protein; migration inhibitory factor-related protein 6; MRP6; Neutrophil S100 protein; p6; Protein S100 A12; S100 calcium binding protein A12; S100 calcium-binding protein A12 (calgranulin C); S100 calcium-binding protein A12; S100A12; S10AC_HUMAN
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
2-92aa
Target Protein Sequence
TKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYHTHKE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
37.4kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Enhance your immunological research with the Recombinant Human Protein S100-A12 (S100A12), a protein with crucial roles in inflammation, immune response, and cellular signaling pathways. S100A12 has been linked to various immune-mediated diseases, making it a potential target for diagnostic and therapeutic applications.

Our Recombinant Human S100A12 protein is produced in a dependable E.coli expression system, ensuring a high-quality and consistent source for your research needs. The full-length mature protein sequence (2-92aa) is N-terminal GST-tagged to facilitate affinity purification while maintaining its native conformation and activity. With a purity greater than 90% as determined by SDS-PAGE, our S100A12 protein guarantees reliable and reproducible results in a variety of experimental setups. Choose between liquid and lyophilized powder forms to best suit your research demands, and harness the power of our premium-quality Recombinant Human S100A12 protein in your immunology research.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
S100A12 is a calcium-, zinc- and copper-binding protein which plays a prominent role in the regulation of inflammatory processes and immune response. Its proinflammatory activity involves recruitment of leukocytes, promotion of cytokine and chemokine production, and regulation of leukocyte adhesion and migration. Acts as an alarmin or a danger associated molecular pattern (DAMP) molecule and stimulates innate immune cells via binding to receptor for advanced glycation endproducts (AGER). Binding to AGER activates the MAP-kinase and NF-kappa-B signaling pathways leading to production of proinflammatory cytokines and up-regulation of cell adhesion molecules ICAM1 and VCAM1. Acts as a monocyte and mast cell chemoattractant. Can stimulate mast cell degranulation and activation which generates chemokines, histamine and cytokines inducing further leukocyte recruitment to the sites of inflammation. Can inhibit the activity of matrix metalloproteinases; MMP2, MMP3 and MMP9 by chelating Zn(2+) from their active sites. Possesses filariacidal and filariastatic activity. Calcitermin possesses antifungal activity against C.albicans and is also active against E.coli and P.aeruginosa but not L.monocytogenes and S.aureus.
Gene References into Functions
  1. S100A12 activates NLPR3 inflammasomes to induce MUC5AC production in airway epithelial cells. ATP induces MUC5AC production in a mechanistically similar mode to S100A12. PMID: 29906464
  2. The results suggest that S100A12 does not participate in the induction of inflammation in dental pulp. However, RAGE can participate in the inflammation in the pulp of males. PMID: 28834384
  3. S100A12 was a significant predictor of lung alveolar infiltration (OR 2.60, 95%CI 1.35-5.00, p = 0.004). These results suggest that S100A12 has the potential to assess the extent of alveolar infiltration in Pulmonary tuberculosis. PMID: 27539060
  4. Results indicated that S100A12 could increase the expression of MMP-2, MMP-9, and vascular cell adhesion molecule 1 (VCAM-1) in HASMCs via activation of ERK1/2 signal pathway, which leads to injury of HASMCs. PMID: 28816402
  5. S100A12 binds to CD36 in the low nanomolar range at the CD36 thrombospondin-1 binding site. PMID: 27734162
  6. data on the antimicrobial activity of S100A12 have been reported. Proinflammatory role of S100A12 is supported by another newly found receptor, Toll-like receptor 4 (TLR4). PMID: 28110121
  7. Report role of fecal S100A12 assay in the diagnosis and management of inflammatory bowel disease. PMID: 28735301
  8. The aim of this mini-review was to outline the pleiotropic actions of S100A12 and to highlight the potential clinical importance of this protein in kidney and cardiovascular diseases. [review] PMID: 29080693
  9. serum levels had significant, positive correlations with intensive care unit length of stay, 28-day mortality, and in-hospital mortality after major abdominal surgery PMID: 27689623
  10. The binding interface between S100A12 and the V domain of RAGE has been identified and mapped. PMID: 27598566
  11. S100A12 functions as a proinflammatory cytokine and activates dermal fibroblasts, causing dermal fibrosis PMID: 27840235
  12. These data suggest that S100A12 is part of an innate and adaptive inducible antimicrobial network that contributes to host defense against mycobacteria in infected macrophages PMID: 27355424
  13. Among the investigated S100-proteins, S100A12 showed the closest association with disease activity and therapeutic response and might therefore provide a valuable biomarker for psoriasis PMID: 26333514
  14. the expression of S100A12 protein and mRNA was downregulated in a large number of clinical samples of GC. Low expression of S100A12 exhibited a marked propensity toward the clinicopathologic features such as tumor size, depth of invasion, TNM stage, Lauren classification, tumor cell differentiation, and poor survival in GC patients. PMID: 26638166
  15. Serum S100A12 was significantly higher in rheumatoid arthritis patients than controls, and was correlated with disease activity. PMID: 26767827
  16. an elevated serum level of S100A12 was an independent determinant of the progression of abdominal aortic calcification determined by lateral lumbar X-ray in Hemodialysis patients. PMID: 26914918
  17. Our findings indicate that chitotriosidase and S10012A are useful in diagnosis and detection of subclinical inflammation and/or assessment of disease activity in FMF patients. PMID: 26339162
  18. This is the first kinetics study of levels of RAGE main isoforms and ligands during ARDS. Elevated sRAGE, HMGB1 and S100A12, with decreased esRAGE and AGEs, were found to distinguish patients with ARDS from those without. PMID: 26274928
  19. serum level elevated in acute liver failure PMID: 25825217
  20. S100A12 is a biomarker of chronic heart failure that may also predict major cardiovascular events in patients with chronic heart failure. PMID: 25438075
  21. High mRNA expression of S100A12 is associated with bladder transitional cell carcinoma. PMID: 25854354
  22. These findings suggested that S100A12 is an effective marker for inflammatory diseases. PMID: 25650963
  23. High serum S100A12 expression is associated with poor response to therapy in Crohn's disease. PMID: 25625487
  24. Suggest that an elevated S100A12 level could play a crucial role in systemic inflammation and may be a promising biomarker for predicting perioperative complications in patients with thoracic aortic dissection. PMID: 24691129
  25. These assays showed that S100A12 is induced in response to Helicobacter pylori infection and inhibits bacterial growth and viability in vitro by binding nutrient zinc. PMID: 25964473
  26. S100A12 might participate in the damage of biliary epithelial cells and hepatocytes in primary biliary cirrhosis. PMID: 25313445
  27. Using a computational approach, the study investigated the modulation of protein structure by different ions in the solution, at different ionic strengths. PMID: 24944024
  28. Data indicate that resistin, S100A12 and soluble receptor for advanced glycation end products (sRAGE) are involved in the pathophysiology of Kawasaki disease (KD). PMID: 23171632
  29. The S100A12 protein was significantly associated with synovitis score in rheumatoid arthritis patients. PMID: 25282581
  30. highlight EN-RAGE as an inflammatory marker for future coronary heart disease (CHD) in a general population, beyond traditional CHD risk factors and inflammatory markers PMID: 25341801
  31. S100A12 is associated with duration of cardiopulmonary bypass, pulmonary inflammation, hypoxia and prolonged mechanical ventilation and may contribute to acute lung injury in cardiac surgery patients. PMID: 24887223
  32. The antimicrobial peptide calcitermin was isolated from human airway secretions and targets Gram-negative bacteria. PMID: 11522286
  33. Serum S100A12 concentrations are correlated with angiographic coronary lesion complexity in patients with coronary artery disease. PMID: 24341566
  34. Correlation of human S100A12 and high-sensitivity C-reactive protein as gingival crevicular fluid and serum markers of inflammation in chronic periodontitis and type 2 diabetes. PMID: 24378957
  35. Excessive expression of the S100A12 gene in uremic leukocytes is relevant to its increased serum concentration, particularly in those affected with cardiovascular disease. PMID: 23921255
  36. S100A12 and hBD2 correlate with the fecal microbiota thus linking the intestinal innate immune response to the bacterial colonization. PMID: 24307989
  37. EN-RAGE inflammatory ligand has an increased expression in Takayasu's arteritis patients. PMID: 23398829
  38. High S100A12 levels are associated with the presence and severity of coronary artery disease in patients with type 2 diabetes mellitus. PMID: 23609464
  39. High S100A12 expression is associated with intestinal inflammation and relapse in inflammatory bowel disease. PMID: 23377171
  40. The results indicate that plasma S100A12 level is an independent predictor for two-year all-cause mortality. A simple integer scoring system was therefore established for predicting mortality on the basis of plasma S100A12 levels. PMID: 23324110
  41. S100A12 could be a novel biomarker for predicting cardiovascular events for predicting MACE in patients with stable CAD. PMID: 22786469
  42. Fecal S100A12 levels were significantly higher in patients with severe necrotizing enterocolitis (NEC) at onset of disease and also, in contrast to fecal calprotectin, at 4-10 days before onset of NEC compared with unaffected reference infants. PMID: 22796048
  43. Significant relationship was found between MMP9 and HMGB1 and EN-RAGE in diabetic patients. PMID: 22549347
  44. Data indicate that S100A12 is up-regulated in Thoracic Aortic Aneurysm Dissection (TAAD) and may contribute to the pathogenesis of TAAD by initiating apoptosis of SMC, at least in part via increased oxidative stress. PMID: 22818064
  45. these data indicate the possible involvement of S100A12 in the development of osteoarthritis by up-regulating MMP-13 and VEGF via p38 MAPK and NF-kappaB pathways. PMID: 22609404
  46. Although S100A12 levels are not elevated in patients with decreased kidney function, a relation to markers of inflammatory disease is found. PMID: 21822023
  47. Levels of serum RAGE are reduced in patients with juvenile rheumatoid arthritis and correlate negatively with disease activity and S100A12 levels. PMID: 21724696
  48. Suggest that elevated plasma EN-RAGE and decreased sRAGE level could play a crucial role in systemic inflammation and carotid atherosclerosis in peritoneal dialysis patients. PMID: 21906738
  49. Transgenic expression of S100A12 in the lung of mice does not exacerbate lung inflammation in a model of OVA-induced allergic inflammation. PMID: 21418345
  50. plasma S100A12 protein level is strongly associated with the prevalence of cardiovascular disease in hemodialysis patients. PMID: 21258041

Show More

Hide All

Subcellular Location
Secreted. Cytoplasm. Cytoplasm, cytoskeleton. Cell membrane; Peripheral membrane protein. Note=Predominantly localized in the cytoplasm. Upon elevation of the intracellular calcium level, translocated from the cytoplasm to the cytoskeleton and the cell membrane. Upon neutrophil activation is secreted via a microtubule-mediated, alternative pathway.
Protein Families
S-100 family
Tissue Specificity
Predominantly expressed by neutrophils, monocytes and activated macrophages. Expressed by eosinophils and macrophages in asthmatic airways in regions where mast cells accumulate. Found in high concentrations in the serum of patients suffering from various
Database Links

HGNC: 10489

OMIM: 603112

KEGG: hsa:6283

STRING: 9606.ENSP00000357726

UniGene: Hs.19413

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*