Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
CAAF1; CAGC; Calcitermin; Calcium-binding protein in amniotic fluid 1; Calgranulin C; Calgranulin-C; Calgranulin-related protein; CGRP; EN RAGE; EN-RAGE; ENRAGE; Extracellular newly identified RAGE-binding protein; migration inhibitory factor-related protein 6; MRP6; Neutrophil S100 protein; p6; Protein S100 A12; S100 calcium binding protein A12; S100 calcium-binding protein A12 (calgranulin C); S100 calcium-binding protein A12; S100A12; S10AC_HUMAN
Species
Homo sapiens (Human)
Target Protein Sequence
TKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYHTHKE
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Enhance your immunological research with the Recombinant Human Protein S100-A12 (S100A12), a protein with crucial roles in inflammation, immune response, and cellular signaling pathways. S100A12 has been linked to various immune-mediated diseases, making it a potential target for diagnostic and therapeutic applications.
Our Recombinant Human S100A12 protein is produced in a dependable E.coli expression system, ensuring a high-quality and consistent source for your research needs. The full-length mature protein sequence (2-92aa) is N-terminal GST-tagged to facilitate affinity purification while maintaining its native conformation and activity. With a purity greater than 90% as determined by SDS-PAGE, our S100A12 protein guarantees reliable and reproducible results in a variety of experimental setups. Choose between liquid and lyophilized powder forms to best suit your research demands, and harness the power of our premium-quality Recombinant Human S100A12 protein in your immunology research.