Recombinant Human Protein S100-A14 (S100A14)

In Stock
Code CSB-YP875728HU
Abbreviation Recombinant Human S100A14 protein
MSDS
Size $276
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
S100A14
Uniprot No.
Research Area
Cancer
Alternative Names
BCMP84; Protein S100-A14; S100 calcium binding protein A14; S100 calcium-binding protein A14; S100a14; S100A15; S10AE_HUMAN; S114
Species
Homo sapiens (Human)
Source
Yeast
Expression Region
1-104aa
Target Protein Sequence
MGQCRSANAEDAQEFSDVERAIETLIKNFHQYSVEGGKETLTPSELRDLVTQQLPHLMPSNCGLEEKIANLGSCNDSKLEFRSFWELIGEAAKSVKLERPVRGH
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
13.7 kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Modulates P53/TP53 protein levels, and thereby plays a role in the regulation of cell survival and apoptosis. Depending on the context, it can promote cell proliferation or apoptosis. Plays a role in the regulation of cell migration by modulating the levels of MMP2, a matrix protease that is under transcriptional control of P53/TP53. Does not bind calcium.
Gene References into Functions
  1. S100A14 is expressed in a subset of lung adenocarcinoma, and its expression is related to certain clinicopathological parameters. Furthermore, S100A14 expression was strongly correlated with migration and invasion in lung adenocarcinoma cells. PMID: 28950283
  2. Increased S100A15 expression and decreased DNA methylation of its gene promoter region were associated with high metastasis potential and poor outcome in lung adenocarcinoma. PMID: 28498804
  3. results indicate that S100A14 may have a role in the induction of differentiation and inhibition of cell metastasis in gastric cancer. PMID: 28726786
  4. We identified a two-gene signature including KCNN4 and S100A14 which was related to recurrence in optimally debulked serous ovarian carcinoma patients PMID: 27270322
  5. Co-expression of S100A14 and S100A16 correlates with a poor prognosis in human breast cancer and promotes cancer cell invasion PMID: 25884418
  6. The antimicrobial peptides psoriasin (S100A7) and koebnerisin (S100A15) suppress extracellular matrix production and proliferation of human fibroblasts PMID: 25502330
  7. S100A14 is expressed in epithelial-like, but not in mesenchymal-like, triple-negative breast cancer cells in vitro. PMID: 25912829
  8. Data show that the genetic variant 425G>A on the 5'-UTR of calcium-binding protein S100A14 was associated with reduced S100A14 expression in gastric cancer (GC) cells. PMID: 25266115
  9. Data indicate that S100A14 has a crucial role in EOC progression, and its overexpression is associated with poor prognosis. PMID: 24939856
  10. Data demonstrate that S100A14 is transcriptionally regulated by JunB and involved in esophageal squamous cell carcinoma cell differentiation. PMID: 24107296
  11. S100A14 interacts with S100A16 and regulates its expression in human cancer cells. PMID: 24086685
  12. Data show that S100A14 and HER2 are colocalized in plasma membrane of breast cancer tissue cells and breast cancer cell lines. PMID: 24285542
  13. High S100A14 expression is associated with metastasis of hepatocellular carcinoma. PMID: 23886191
  14. The solution structure of homodimeric S100A14 in the apo state solved by NMR PMID: 23197251
  15. that S100A14 promotes cell motility and invasiveness by regulating the expression and function of MMP2 in a p53-dependent manner. PMID: 22451655
  16. S100A14 provides a novel role in oral squamous cell carcinoma cell proliferation by inducing G1-arrest PMID: 22032898
  17. S100A14 induces cell apoptosis is partially in a RAGE-dependent manner PMID: 21559403
  18. S100A14 and S100A4 have roles in metastasis in colorectal cancer after surgery PMID: 19956863
  19. Data constitute strong evidence in support of the notion that S100A14 might function as a cancer suppressor working in the P53 pathway and play a role in esophageal carcinogenesis. PMID: 19351828

Show More

Hide All

Subcellular Location
Cytoplasm.
Protein Families
S-100 family
Tissue Specificity
Expressed at highest levels in colon and at moderate levels in thymus, kidney, liver, small intestine, and lung. Low expression in heart and no expression is seen in brain, skeletal muscle, spleen, placenta and peripheral blood leukocytes.
Database Links

HGNC: 18901

OMIM: 607986

KEGG: hsa:57402

STRING: 9606.ENSP00000340463

UniGene: Hs.288998

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*