Recombinant Human Proton-coupled zinc antiporter SLC30A8 (SLC30A8), partial

In Stock
Code CSB-EP818247HU1c7
Abbreviation Recombinant Human SLC30A8 protein, partial
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 95% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Others
Alternative Names
Solute carrier family 30 member 8;Zinc transporter 8
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
267-369aa
Target Protein Sequence
LKDFSILLMEGVPKSLNYSGVKELILAVDGVLSVHSLHIWSLTMNQVILSAHVATAASRDSQVVRREIAKALSKSFTMHSLTIQMESPVDQDPDCLFCEDPCD
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
18.3 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.158.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Facilitates the accumulation of zinc from the cytoplasm into intracellular vesicles, being a zinc-efflux transporter. May be a major component for providing zinc to insulin maturation and/or storage processes in insulin-secreting pancreatic beta-cells.
Gene References into Functions
  1. ZnT8 Arg325Trp polymorphism is associated with enhanced inflammation in type 2 diabetes. PMID: 30142362
  2. the effects of the interaction between ZNT8 rs13266634 and dietary factors on the risk of Metabolic syndrome S were investigated in this study. PMID: 28490771
  3. HLA-A*24, the SLC30A8 T allele and high BMI are associated with poor graft outcome in type 1 diabetics undergoing pancreatic islet transplantation. PMID: 29679103
  4. The findings reported herein that the diabetes risk genotype C/C at SNP rs13266634 of the SLC30A8 gene encoding the beta-cell Zn transporter ZnT8 is associated with a higher total islet Zn concentration, is potentially of clinical significance. PMID: 28352089
  5. Results demonstrate that SLC30A8 rs2466293 was associated with T1D predisposition in brazilians with non-European descents. PMID: 28303020
  6. is a valuable biological marker to classify newly-diagnosed diabetics PMID: 29288641
  7. common single nucleotide polymorphisms confer risk susceptibility to type 2 diabetes; DNA methylation levels are increased in type 2 diabetes patients [review] PMID: 26593983
  8. These findings of differential cytolocation of ZnT8 isoforms could be relevant for beta-cell zinc metabolism in health and disease. PMID: 28965566
  9. rs13266634/T SNP (SLC30A8) is a suggestive protective variant against gestational diabetes mellitus development. PMID: 28072873
  10. High Arg-325 variant in ZnT8 is associated with Risk for Type-2 Diabetes. PMID: 27875315
  11. The results provide a strong evidence for independent association between type 2 diabetes mellitus and SNPs for in TCF7L2 and SLC30A8. PMID: 27310578
  12. this is the first study to report a significant association between the R325W C-allele of SLC30A8 and increased risk of developing gestational diabetes mellitus. All of the autoantibody positive women with GDM who developed postpartum type 1 diabetes were positive for autoantibodies against glutamic acid decarboxylase. Thus ZnT8A did not have any additional predictive value in postpartum development of type 1 diabetes. PMID: 27003436
  13. Although previous meta-analyses have shown that this association was only found in Asian and European groups, and not in African populations, our analysis revealed the deleterious effect of SLC30A8 rs13266634 on type 2 diabetes mellitus in an African population when stratified by ethnicity under additive model even with a small number of studies. PMID: 26832344
  14. Results indicate a lack of association of the SLC30A8 SNPs with type 2 diabetes in Mexican American families. PMID: 27896278
  15. The hZnT8 R325W transgenic line had lower pancreatic [Zn(2+)]i and proinsulin and higher insulin and glucose tolerance compared with control littermates after 10 weeks of a high-fat diet in male mice. The converse was true for the hZnT8 WT transgenic line, and dietary Zn(2+) supplementation also induced glucose intolerance. PMID: 27899481
  16. Data indicate that gestational weight gain may modify SLC30A8 variant on long-term glycemic changes, highlighting the importance of gestational weight control in the prevention of postpartum hyperglycemia in women with GDM. PMID: 27600066
  17. We investigated the association of the polymorphisms rs13266634 (SLC30A8) in a case-control study in Euro-Brazilians with gestational diabetes. The minor allele frequencies, for healthy and gestational diabetes, respectively, for the T-allele (SLC30A8 gene rs13266634) were 27.8% (95%CI = 23-32%) vs 23.5% (95%CI = 18-29%), P = 0.227. Genotype comparisons showed no significant difference. PMID: 28363002
  18. Two miR-binding SNPs SLC30A8 rs2466293 and INSR rs1366600 increased Gestational diabetes mellitus susceptibility. Functional studies were required to confirm the underlying mechanism. PMID: 28190110
  19. we have successfully constructed a T1D phage display antibody library and identified two ZnT8-specific scFv clones, C27 and C22. These ZnT8-specific scFvs are potential agents in immunodiagnostic and immunotherapy of T1D PMID: 27270580
  20. Results obtained for ZnT8A measurement using ELISA were consistent with previous data. Such investigation could improve the risk stratification and would be integrated in our daily practice PMID: 27363941
  21. Detection of ZnT8 antibodies in blood precedes detection of classical islet antibodies in children at risk of developing diabetes mellitus type 1. PMID: 26824044
  22. Studies indicate that people who have particular mutations in a gene called SLC30A8 (Solute carrier family 30, member 8) are 65% less likely to get diabetes. PMID: 26957571
  23. Association between SLC30A8 rs13266634 Polymorphism and Type 2 Diabetes Risk PMID: 26214053
  24. Size and the direction of the effect of SLC30A8 risk alleles in man. PMID: 25287711
  25. Zinc supplementation appears to affect the early insulin response to glucose differentially by rs13266634 genotype and could be beneficial for diabetes prevention and/or treatment for some individuals based on SLC30A8 variation. PMID: 25348609
  26. Suggest rs3019885 SLC30A8 SNP is not a susceptibility factor for abdominal aortic aneurysms in an Italian population. PMID: 24423473
  27. These data demonstrate that T1D patients may have single amino acid-specific autoantibodies directed against either ZnT8R or ZnT8W and that the autoantibody affinity to the respective variant may be different. PMID: 25178386
  28. zinc transporter 8 and MAP3865c homologous epitopes are recognized by Hashimoto's thyroiditis subjects from Sardinia PMID: 24830306
  29. Thus, rs13266634 polymorphism might play a significant role in lipid metabolism and cardiovascular risk in HIV/hepatitis C-coinfected patients. PMID: 24499956
  30. No significant difference was found between the normal and diabetic subjects regarding the rs13266634 C/T polymorphism in SLC30A8 gene. PMID: 24449369
  31. Individual common and an aggregate of rare genetic variation in SLC30A8 are associated with measures of beta-cell function in the diabetes prevention program. PMID: 24471563
  32. Our study suggested that the C allele of rs13266634 was associated with higher odds of T2D, and higher plasma zinc was associated with lower odds. The inverse association of plasma zinc concentrations with T2D was modified by SLC30A8 rs13266634. PMID: 24306209
  33. Antibodies for ZnT8 is related to age and metabolic status at diagnosis as well as HLA genotype but does not significantly improve the detection rate of beta-cell autoimmunity in Finnish children and adolescents affected by Type 1 diabetes. PMID: 23861236
  34. SLC30A8 haploinsufficiency protects against type 2 diabetes, suggesting ZnT8 inhibition as a therapeutic strategy in type 2 diabetes prevention. PMID: 24584071
  35. Men with two copies of the allele that protects against type 2 diabetes showed less post-exercise bout strength loss, less soreness, and lower creatine kinase values. PMID: 24101675
  36. Zinc transporter 8 and MAP3865c homologous epitopes are recognized at T1D onset in Sardinian children. PMID: 23696819
  37. ZnT8A were more common and more persistent in patients with LADA compared to adult-onset type 1 diabetes, but their presence was not associated with specific phenotypic characteristics. PMID: 23194113
  38. SLC30A8 regulates hepatic insulin clearance. PMID: 24051378
  39. Analysis of ZnT8A increased the diagnostic sensitivity of islet autoantibodies for T1D as only 7% remained islet autoantibody negative. The association between DQ6.4 and all three ZnT8A may be related to ZnT8 antigen presentation by the DQ6.4 heterodimer. PMID: 22957668
  40. Humoral responses to islet antigen-2 and zinc transporter 8 are attenuated in patients carrying HLA-A*24 alleles at the onset of type 1 diabetes. PMID: 23396399
  41. ZnT8-specific CD4(+) T cells are skewed towards Th1 cells in type 1 diabetes mellitus patients. PMID: 23390544
  42. Carriers of the TT genotype of the SLC30A8 gene predict lower stimulated C-peptide levels 12 months after type 1 diabetes diagnosis. PMID: 22686132
  43. The humoral autoreactivity to ZnT8 depends on the clinical phenotype, which may provide clues to understand the role of this protein in the pathogenesis of type 1 diabetes. PMID: 22447136
  44. The SLC30A8 gene variation does not appear to contribute a genetic basis for the co-occurrence of schizophrenia and T2DM PMID: 22778022
  45. At diagnosis of type 1 diabetes in non-Swedes, the presence of ZnT8-RA autoantibodies rather than ZnT8-WA was likely due to effects of HLA-DQ2 and the SLC30A8 genotypes. PMID: 22787139
  46. Data conclude that type 2 diabetes is associated with the AA genotype of rs11558471 in the human SLC30A8 gene. PMID: 22653633
  47. ZNT8 expression responds to variation in zinc and lipid levels in human beta cells, with repercussions on insulin secretion. PMID: 22582094
  48. ZnT8A testing in combination with other autoantibodies facilitates disease prediction, despite the biomarker not being under the same genetic control as the disease. PMID: 22526605
  49. ZnT8-reactive CD8(+) T cells are directed against the ZnT8(186-194) epitope and are detected in a majority of IDDM patients. The exceptional immunodominance of ZnT8(186-194) may point to common environmental triggers precipitating beta cell autoimmunity. PMID: 22526607
  50. ZnT8A identified a subset at higher diabetes risk. ZnT8A predicted diabetes independently of ICA, the standard BAA, age, and HLA type. ZnT8A should be included in type 1 diabetes prediction and prevention studies PMID: 22446173

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Cytoplasmic vesicle, secretory vesicle membrane; Multi-pass membrane protein.
Protein Families
Cation diffusion facilitator (CDF) transporter (TC 2.A.4) family, SLC30A subfamily
Tissue Specificity
In the endocrine pancreas, expressed in insulin-producing beta cells. Expressed at relatively high levels in subcutaneous fat tissue from lean persons; much lower levels in visceral fat, whether from lean or obese individuals, and in subcutaneous fat tiss
Database Links

HGNC: 20303

OMIM: 125853

KEGG: hsa:169026

STRING: 9606.ENSP00000415011

UniGene: Hs.532270

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*