Recombinant Human Pulmonary surfactant-associated protein C (SFTPC)

Discontinued
Code CSB-MP021174HU
Abbreviation Recombinant Human SFTPC protein
MSDS
Size $440
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Transport
Alternative Names
BRICD6; BRICHOS domain containing 6; PSP C; PSPC; PSPC_HUMAN; Pulmonary surfactant apoprotein 2; Pulmonary surfactant apoprotein PSP C; pulmonary surfactant apoprotein-2 SP-C; Pulmonary surfactant associated protein C; Pulmonary surfactant associated proteolipid SPL pVal; Pulmonary surfactant associated proteolipid SPL(Val); Pulmonary surfactant protein SP5; Pulmonary surfactant-associated protein C; Pulmonary surfactant-associated proteolipid SPL(Val); SFTP 2; SFTP2; SFTPC; SFTPC surfactant pulmonary associated protein C; SMDP2; SP 5; SP C; SP-C; SP5; SPC; Surfactant associated protein pulmonary 2; Surfactant protein c; Surfactant proteolipid SPL-pVal; Surfactant pulmonary associated protein C
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
24-58aa
Target Protein Sequence
FGIPCCPVHLKRLLIVVVVVVLIVVVIVGALLMGL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
7.7kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Pulmonary surfactant associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces.
Gene References into Functions
  1. S186N polymorphism associated with severity of preterm neonate respiratory distress PMID: 27884070
  2. a novel mutation in SFTPC [c.435G->A, p.(Gln145)] that was associated with onset of symptoms in early infancy, progressive respiratory failure with need for prolonged support, and eventual lung transplant at 1 year of age (Review) PMID: 27362365
  3. c.435G>C variant in the SFTPC gene associated with fatal neonatal respiratory distress syndrome. The c.435G>C mutation is deleterious not because of its amino acid substitution but because of its subsequent splicing defect and should be referred to as r.325_435del and p.Leu109_Gln145del. PMID: 28295039
  4. an intricate link between caveolin-1 and Src kinase-mediated cell signaling and alveolar epithelial cell apoptosis due to loss of SP-C expression through p53 and uPA system-mediated cross-talk, is reported. PMID: 28385810
  5. Rare mutations in surfactant-associated genes contribute to neonatal respiratory distress syndrome. The frequency of mutations in these genes in the Chinese population is unknown. We resequenced all exons of the surfactant protein-C (SFTPC) and we did not find any rare mutations in SFTPC PMID: 26547207
  6. In interstitial lung disease, abnormal proSP-C was seen in small and dense lamellar bodies in type II alveolar epithelial cells. A549 cells expressing proSP-C(L55F) had abnormal organelles. It partly colocalized in CD63-positive cytoplasmic vesicles . PMID: 26375473
  7. We sequenced SFTPC and analyzed morphology, ultrastructure and SP expression in lung tissue when available. We identified eight subjects who were heterozygous for SP-C mutations. PMID: 25782673
  8. analysis of clinical patterns in patients with SFTPC mutations PMID: 25657025
  9. support a chaperone function of the BRICHOS domain, possibly together with the linker region, during pro-SP-C biosynthesis in the endoplasmic reticulum PMID: 26041777
  10. cleavage of BRICHOS in a loop region that is cleaved during proSP-C biosynthesis results in increased capacity to delay Abeta(42) fibril formation. PMID: 25891900
  11. Structural modeling of transmembrane (BRICHOS) domains of SFTPC precursor and BRI2/ITM2B (integral membrane protein 2B) identifies conserved region structurally complementary to beta-sheet-/amyloid-prone regions in BRICHOS domain-containing proteins. PMID: 24099305
  12. The A116D mutation leads to impaired processing of proSP-C in alveolar epithelial cells, alters cell viability and lipid composition, and also activates cells of the immune system. PMID: 22458263
  13. (surfactant protein C), a specific functional marker of human type II alveolar epithelial cells, was detected in differentiated cells by RT-PCR (reverse transcription-PCR) analysis after day 15. PMID: 21542803
  14. Several genetic abnormalities have been associated with familial pulmonary fibrosis. The present study examined the genes coding for surfactant protein-C, ATPbinding cassette protein A3 and telomerase, and found no abnormalities. PMID: 21165348
  15. Mutation increases endoplasmic reticulum stress and induces apoptotic cell death compared with wild-type SP-C in alveolar type II cells, supporting the significance of this mutation in the pathogenesis of pulmonary fibrosis. PMID: 21828032
  16. Data show that, in contrast to its wild-type counterpart, SP-C(I73T) is misdirected to the plasma membrane and subsequently internalized to the endocytic pathway via early endosomes, leading to the accumulation of abnormally processed proSP-C isoforms. PMID: 21707890
  17. Our study indicates that missense single nucleotide polymorphisms and haplotypes of SFTPA1, SFTPA2 and SFTPD are associated with susceptibility to community-acquired pneumonia(CAP), and that several haplotypes also influence severity and outcome of CAP. PMID: 21310059
  18. misfolded surfactant protein C has a role in endoplasmic reticulum stress in epithelial-mesenchymal transition of alveolar epithelial cells PMID: 21169555
  19. sequencing of the five translated exons of the SFTPC gene1 from blood samples demonstrated the same heterozygous I73T substitution in both the child and the mother; neither of them had mutation of the SFTPB and ABCA3 genes. PMID: 21248320
  20. JNK signaling has a role in mediating SP-C BRICHOS-induced cytokine release PMID: 20463293
  21. children with SFTPC mutation associated lung diseases have HRCT pattern that were characterized by ground-glass opacities that were predominately diffuse but can be patchy in some cases and lung cysts with thin wall and different sizes. PMID: 20658481
  22. Mutations in the gene encoding surfactant protein C (SFTPC) have been found in children and families with idiopathic pneumonias PMID: 20656946
  23. I73T mutation of SFTPC protein leads to impaired processing of proSP-C in alveolar type II cells, alters their stress tolerance and surfactant lipid composition, and activates cells of the immune system. PMID: 21092132
  24. Reduced SFTPC transcription contributes to the genetic risk for neonatal respiratory distress syndrome in developmentally susceptible infants. PMID: 20539253
  25. two novel mutations were identified in highly conserved areas of the SFTPC gene, and show that heterozygotes for the mutations have normal lung function and are unaffected by COPD and interstitial lung disease. PMID: 19910179
  26. Although neonatal presentation may be observed in some patients with mutations in the BRICHOS domain, surfactant protein C gene (SFTPC)-associated lung disease usually presents within the first months of life with cough, tachypnoea and failure to thrive. PMID: 20403820
  27. The human SP-C promoter sequence will enhance gene expression specifically in alveolar type II epithelial cells in mouse lung. PMID: 20054353
  28. Subclinical fibrotic changes may be present in family members of patients with SFTPC mutation-associated interstitial lung disease and suggest ABCA3 variants could affect disease pathogenesis. PMID: 20371530
  29. SFTPC SNP rs4715 associates with the duration of preterm premature rupture of fetal membranes, and SP-C is expressed in gestational tissues. We propose that fetal SFTPC moderates inflammatory activation within the fetal extra-embryonic compartment PMID: 19735006
  30. Data show that knockdown of MKS3 inhibited degradation of mutant SP-C. PMID: 19815549
  31. review of synthesis and post-translational processing of surfactant protein C PMID: 11699575
  32. mutations causally related to familial interstitial lung disease PMID: 11893657
  33. Biosynthesis of surfactant protein C (SP-C). Sorting of SP-C proprotein involves homomeric association via a signal anchor domain PMID: 11907042
  34. associated with usual interstitial pneumonitis and cellular nonspecific interstitial pneumonitis in one kindred PMID: 11991887
  35. role of cathepsin H in processing in pneumocytes PMID: 12034564
  36. surfactant protein C processing requires a type II transmembrane topology directed by juxtamembrane positively charged residues PMID: 12933801
  37. surfactant protein C has a role in interstitial lung disease and lung development PMID: 14525980
  38. An incompletely processed form of SP-C precursor found in association with childhood SP-B deficiency associates with surfactant phospholipids and is secreted into the airspaces with the large aggregate form of surfactant, but it lacks surface activity. PMID: 15049696
  39. Observations suggest that individuals with this particular mutation in surfactant protein C gene might be at increased risk of interstitial lung disease of variety of types. PMID: 15133475
  40. NMR solution structure and analysis of potential C-terminal dimerization site of a recombinant mutant of surfactant-associated protein C. PMID: 15153097
  41. Missense mutation of the surfactant protein C gene is associated with interstitial lung disease in newborn. PMID: 15293602
  42. proSP-C BRICHOS mutations induce a dynamic toxic gain-of-function, causing apoptotic cell death both by early ER accumulation leading to an exaggerated unfolded protein response and by enhanced deposition of cellular aggregates associated with proteasome PMID: 15778495
  43. Infection of cells expressing mutant SP-C with respiratory syncytial virus resulted in significantly enhanced cytotoxicity associated with accumulation of the mutant proprotein, pronounced activation of the unfolded protein response, and cell death. PMID: 16449190
  44. Erm is involved in SP-C regulation, which results from an interaction with TTF-1 PMID: 16613858
  45. Recombinant SP-C forms improved movement of phospholipid molecules into the interface (during adsorption), or out from the interfacial film (during compression) PMID: 16631109
  46. Brichos domain-containing C-terminal part of pro-surfactant protein C binds to an unfolded poly-val transmembrane segment PMID: 16709565
  47. The influence of palmitoylation was studied for full length SP-Cs as well as truncated variants with the N-terminal residues 1-17 and 1-13, respectively. PMID: 17051367
  48. an inverse SFTPC haplotype distribution was found between children with asthma and respiratory syncytial virus infection PMID: 17121584
  49. These results suggest common cellular responses, including initiation of cell-death signaling pathways, to these lung disease-associated SP-C BRICHOS domain proteins. PMID: 17586700
  50. finding of heterozygosity for ABCA3 mutations in severely affected infants with SFTPC I73T, and independent inheritance from disease-free parents supports that ABCA3 acts as a modifier gene for the phenotype associated with an SFTPC mutation. PMID: 17597647

Show More

Hide All

Involvement in disease
Pulmonary surfactant metabolism dysfunction 2 (SMDP2); Respiratory distress syndrome in premature infants (RDS)
Subcellular Location
Secreted, extracellular space, surface film.
Database Links

HGNC: 10802

OMIM: 178620

KEGG: hsa:6440

STRING: 9606.ENSP00000316152

UniGene: Hs.1074

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*