Recombinant Human Putative RNA-binding protein 3(RBM3)

Code CSB-EP019420HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. P98179
Relevance Cold-inducible mRNA binding protein that enhances global protein synthesis at both physiological and mild hypothermic tperatures. Reduces the relative abundance of microRNAs, when overexpressed. Enhances phosphorylation of translation initiation factors and active polysome formation .
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias RNA-binding motif protein 3RNPL
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MSSEEGKLFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASVAMRAMNGESLDGRQIRVDHAGKSARGTRGGGFGAHGRGRSYSRGGGDQGYGSGRYYDSRPGGYGYGYGRSRDYNGRNQGGYDRYSGGNYRDNYDN
Research Area Epigenetics and Nuclear Signaling
Source E.coli
Gene Names RBM3
Expression Region 1-157aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 33.2kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Cold-inducible mRNA binding protein that enhances global protein synthesis at both physiological and mild hypothermic temperatures. Reduces the relative abundance of microRNAs, when overexpressed. Enhances phosphorylation of translation initiation factors and active polysome formation (By similarity).
Subcellular Location Nucleus, Cytoplasm, Cell projection, dendrite
Database Links

HGNC: 9900

OMIM: 300027

KEGG: hsa:5935

STRING: 9606.ENSP00000365946

UniGene: Hs.301404

Related Products

RBM3 Antibodies

RBM3 Antibodies for Homo sapiens (Human)

RBM3 Antibodies for Human

RBM3 Proteins

RBM3 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.