Code | CSB-EP019420HU |
Size | US$1726 |
Image |
Purity | Greater than 90% as determined by SDS-PAGE. |
Target Names | RBM3 |
Uniprot No. | P98179 |
Research Area | Epigenetics and Nuclear Signaling |
Alternative Names | RNA-binding motif protein 3RNPL |
Species | Homo sapiens (Human) |
Source | E.coli |
Expression Region | 1-157aa |
Target Protein Sequence | MSSEEGKLFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASVAMRAMNGESLDGRQIRVDHAGKSARGTRGGGFGAHGRGRSYSRGGGDQGYGSGRYYDSRPGGYGYGYGRSRDYNGRNQGGYDRYSGGNYRDNYDN Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
Mol. Weight | 33.2kDa |
Protein Length | Full Length |
Tag Info | N-terminal 6xHis-SUMO-tagged |
Form |
Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. |
Datasheet & COA | Please contact us to get it. |
Still Have Questions? | Leave a Message or Start an on-line Chat |
Function | Cold-inducible mRNA binding protein that enhances global protein synthesis at both physiological and mild hypothermic temperatures. Reduces the relative abundance of microRNAs, when overexpressed. Enhances phosphorylation of translation initiation factors and active polysome formation (By similarity). |
Subcellular Location | Nucleus, Cytoplasm, Cell projection, dendrite |
Database Links |
HGNC: 9900 OMIM: 300027 KEGG: hsa:5935 STRING: 9606.ENSP00000365946 UniGene: Hs.301404 |
Recombinant Staphylococcus aureus Clumping factor A(clfA),partial
Express system: E.coli
Species: Staphylococcus aureus (strain MSSA476)
Recombinant Human Bone marrow proteoglycan(PRG2),partial
Express system: in vitro E.coli expression system
Species: Homo sapiens (Human)
Recombinant Human Phospholipase A2, membrane associated(PLA2G2A)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Rat Beta-nerve growth factor(Ngf)
Express system: Yeast
Species: Rattus norvegicus (Rat)
Recombinant Human Plasma kallikrein(KLKB1),partial
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human Butyrophilin subfamily 3 member A3(BTN3A3),partial
Express system: Yeast
Species: Homo sapiens (Human)