Recombinant Human Putative RNA-binding protein 3 (RBM3)

Code CSB-YP019420HU
Abbreviation Recombinant Human RBM3 protein
MSDS
Size $250
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
RBM3
Uniprot No.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
2600016C11Rik; IS1 RNPL; MGC105811; MGC118410; OTTHUMP00000025800; OTTHUMP00000025802; OTTMUSP00000019634; OTTMUSP00000019635; OTTMUSP00000019636; Putative RNA binding protein 3; Putative RNA-binding protein 3; Rbm3; RBM3_HUMAN; RNA binding motif (RNP1; RRM) protein 3; RNA binding motif protein 3; RNA-binding motif protein 3; RNA-binding protein 3; RNPL; RP23-27I6.7
Species
Homo sapiens (Human)
Source
Yeast
Expression Region
1-157aa
Target Protein Sequence
MSSEEGKLFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASVAMRAMNGESLDGRQIRVDHAGKSARGTRGGGFGAHGRGRSYSRGGGDQGYGSGRYYDSRPGGYGYGYGRSRDYNGRNQGGYDRYSGGNYRDNYDN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
19.2kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Cold-inducible mRNA binding protein that enhances global protein synthesis at both physiological and mild hypothermic temperatures. Reduces the relative abundance of microRNAs, when overexpressed. Enhances phosphorylation of translation initiation factors and active polysome formation.
Gene References into Functions
  1. Results showed that high RBM3 expression in gastric cancer is mainly found in intestinal-type of Lauren grade and is associated with longer overall survival time. PMID: 29263314
  2. Overexpression of RBM3 rescued SH-SY5Y cells from UV-induced apoptosis. PMID: 28831692
  3. RBM3 is overexpressed in bipolar disorder patients responding to lithium treatment compared to non-responders. PMID: 28616776
  4. Loss of RBM3 expression is an unfavourable prognostic marker in colorectal cancers (CRCs), and is linked to right-sided tumour localization. PMID: 25922889
  5. High RBM3 expression is an independent predictor of prolonged survival in metastatic colorectal cancer patients. PMID: 28800641
  6. Results show that RBM3 overexpression results in increased stemness in colon cancer cells, and inactivation of GSK3 through phosphorylation, thereby enhancing b-catenin signaling activity the colorectal cancer cells. PMID: 26331352
  7. Low RBM3 expression is associated with colon Cancer. PMID: 28373441
  8. Studies showed RBM3 as one of the important cold shock protein with critical roles in rapid cell adaption to the alterations of the environmental stress. Also, RBM3 plays an important role in neuroprotection, anti-apoptotic functions, cell proliferation as well as its function as proto-oncogene.[review] PMID: 27364162
  9. The results indicate the existence of a negative feedback loop that regulates fever via reduced RBM3 levels and increased expression of miR-142-5p and miR-143. PMID: 26825461
  10. Low RBM3 immunoexpression is associated with urothelial carcinoma of the bladder. PMID: 26577765
  11. RBM3 may be a potential biomarker for treatment stratification in patients with metastatic non-seminomatous germ cell tumours. PMID: 25811459
  12. High RBM3 expression is an independent prognostic marker in prostate cancer. PMID: 24380696
  13. The data suggest that the overexpression of RBM3 may serve as an important molecular mechanism underlying astrocytic carcinogenesis. PMID: 23673116
  14. A novel role of RBM3 in linking stress-regulated RNA splicing to tumorigenesis. PMID: 23667174
  15. Loss of RBM3 expression is associated with more aggressive tumors and poorer prognosis of urothelial bladder cancer. Findings may indicate that loss of RBM3 expression results in a phenotype more prone to metastatic spread than local aggressiveness. PMID: 23565664
  16. the inverse association and prognostic impact of MCM3 and RBM3 expression indicate a possible interaction of these proteins in melanoma progression PMID: 22805320
  17. high tumor-specific nuclear expression of RBM3 is an independent predictor of good prognosis in colorectal cancer PMID: 21956899
  18. high nuclear expression of RBM3 in prostate cancer is associated with a prolonged time to disease progression PMID: 21955582
  19. RBM3 is down-regulated in metastatic melanoma and high nuclear RBM3 expression in the primary tumour is an independent marker of a prolonged overal survival. PMID: 21777469
  20. RBM3 may be a useful prognostic and treatment predictive marker in epithelial ovarian cancer. PMID: 20727170
  21. RBM3 is a critical factor providing cellular survival advantages in an adverse microenvironment presumably by restoring translation efficacy PMID: 19770690
  22. Nuclear RBM3 is an independent favorable prognostic factor in breast cancer, and seems to have a specific role in estrogen receptor-positive tumors. PMID: 19734850
  23. RBM3 and CIRP are adaptatively expressed in response to hypoxia by a mechanism that involves neither HIF-1 nor mitochondria PMID: 15075239
  24. From these results, it seems that the X-chromosome, through its RBM genes, plays a formerly unknown role in the regulation of programmed cell death (apoptosis) in breast cancer. PMID: 16552754
  25. the RNA stabilizing and translation regulatory protein RBM3 is a novel proto-oncogene that induces transformation when overexpressed and is essential for cells to progress through mitosis. PMID: 18427544
  26. pharmacological modulation of RBM3 and CIRBP may represent novel therapeutic approaches for prostate cancer. PMID: 19277990

Show More

Hide All

Subcellular Location
Nucleus. Cytoplasm. Cell projection, dendrite.
Database Links

HGNC: 9900

OMIM: 300027

KEGG: hsa:5935

STRING: 9606.ENSP00000365946

UniGene: Hs.301404

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*