Recombinant Human Putative inactive neutral ceramidase B(ASAH2B)

Code CSB-EP002171HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. P0C7U1
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias ASAH2-like protein;Putative inactive N-acylsphingosine amidohydrolase 2B;Putative inactive non-lysosomal ceramidase B
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MRQHRQFMDRTHYLLTFSSSETLLRLLLRIVDRAPKGRTFGDVLQPAKPEYRVGEVAEVIFVGANPKNSVQNQTHQTFLTVEKYEATSTSWQIVCNDASWETRFYWHKGLLGLSNATVEWHIPDTAQPGIYRIRYFGHNRKQDILKPAVILSFEGTSPAFEVVTI
Research Area Signal Transduction
Source E.coli
Gene Names ASAH2B
Expression Region 1-165aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 23.0kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat

Related Products

ASAH2B Antibodies

ASAH2B Antibodies for Homo sapiens (Human)

ASAH2B Proteins

ASAH2B Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.