Recombinant Human Ras-related protein Rab-5B(RAB5B)

Code CSB-EP019214HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. P61020
Relevance Protein transport. Probably involved in vesicular traffic .
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence TSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQSVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQETFARAKTWVKELQRQASPSIVIALAGNKADLANKRMVEYEEAQAYADDNSLLFMETSAKTAMNVNDLFLAIAKKLPKSEPQNLGGAAGRSRGVDLHEQSQQNKSQCCSN
Research Area Neuroscience
Source E.coli
Gene Names RAB5B
Protein Names Recommended name: Ras-related protein Rab-5B
Expression Region 1-215aa
Tag Info N-terminal GST-tagged
Mol. Weight 50.6kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Protein transport. Probably involved in vesicular traffic (By similarity).
Subcellular Location Cell membrane, Lipid-anchor, Cytoplasmic side, Early endosome membrane, Lipid-anchor, Melanosome
Protein Families Small GTPase superfamily, Rab family
Database Links

HGNC: 9784

OMIM: 179514

KEGG: hsa:5869

STRING: 9606.ENSP00000353444

UniGene: Hs.157659

Pathway Ras signaling pathway
Endocytosis

Related Products

RAB5B Antibodies

RAB5B Antibodies for Homo sapiens (Human)

RAB5B Antibodies for Human

RAB5B Proteins

RAB5B Proteins for Homo sapiens (Human)

RAB5B ELISA Kit

RAB5B ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.