Recombinant Human Ras-specific guanine nucleotide-releasing factor RalGPS1 (RALGPS1)

In Stock
Code CSB-EP683358HU
Abbreviation Recombinant Human RALGPS1 protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
RALGPS1
Uniprot No.
Research Area
Signal Transduction
Alternative Names
RALGPS1; KIAA0351; RALGEF2; Ras-specific guanine nucleotide-releasing factor RalGPS1; Ral GEF with PH domain and SH3-binding motif 1; Ral guanine nucleotide exchange factor 2; RalGEF 2; RalA exchange factor RalGPS1
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-305aa
Target Protein Sequence
MYKRNGLMASVLVTSATPQGSSSSDSLEGQSCDYASKSYDAVVFDVLKVTPEEFASQITLMDIPVFKAIQPEELASCGWSKKEKHSLAPNVVAFTRRFNQVSFWVVREILTAQTLKIRAEILSHFVKIAKKLLELNNLHSLMSVVSALQSAPIFRLTKTWALLNRKDKTTFEKLDYLMSKEDNYKRTREYIRSLKMVPSIPYLGIYLLDLIYIDSAYPASGSIMENEQRSNQMNNILRIIADLQVSCSYDHLTTLPHVQKYLKSVRYIEELQKFVEDDNYKLSLRIEPGSSSPRLVSSKEDLAAM
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
50.7kDa
Protein Length
Full Length of Isoform 4
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Amino acids 1-305 constitute the expression domain of recombinant Human RALGPS1. The calculated molecular weight for this RALGPS1 protein is 50.7 kDa. This protein is generated in a e.coli-based system. Fusion of the N-terminal 6xHis-SUMO tag into the RALGPS1 encoding gene fragment was conducted, allowing for easier detection and purification of the RALGPS1 protein in subsequent stages.

Human ras-specific guanine nucleotide-releasing factor RALGPS1 is a key regulator of the Ras small GTPases. RALGPS1 activates RalA and RalB, influencing cellular processes like vesicle trafficking, cell migration, and oncogenic transformation. In cancer research, RALGPS1 is implicated in tumor progression and metastasis, making it a potential therapeutic target. In cell biology, RALGPS1 is essential for understanding Ras signaling and intracellular dynamics. Additionally, RALGPS1 plays a role in synaptic transmission and neurodevelopment. Investigating RALGPS1 provides insights into molecular mechanisms of Ras activation, offering potential applications in cancer therapeutics, neurological research, and broader cell signaling studies, enhancing the understanding of cellular processes and diseases.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Guanine nucleotide exchange factor (GEF) for the small GTPase RALA. May be involved in cytoskeletal organization. Guanine nucleotide exchange factor for.
Gene References into Functions
  1. The guanine-nucleotide exchange factor (GEF) RalGPS1a activates small GTPase Ral proteins such as RalA and RalB by stimulating the exchange of Ral bound GDP to GTP, thus regulating various downstream cellular processes. PMID: 21494904
Subcellular Location
Cytoplasm. Cell membrane. Note=Associates with membranes through the PH domain.
Tissue Specificity
Widely expressed (at protein level). Isoform 2 is expressed in brain, colon, kidney, pancreas, prostate, skeletal muscle, small intestine, testis, thymus and uterus. Isoform 1 is expressed at high levels in heart and testis and at lower levels in brain, p
Database Links

HGNC: 16851

OMIM: 614444

KEGG: hsa:9649

UniGene: Hs.432842

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*