Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Signal Transduction
Alternative Names
RALGPS1; KIAA0351; RALGEF2; Ras-specific guanine nucleotide-releasing factor RalGPS1; Ral GEF with PH domain and SH3-binding motif 1; Ral guanine nucleotide exchange factor 2; RalGEF 2; RalA exchange factor RalGPS1
Species
Homo sapiens (Human)
Expression Region
1-305aa
Target Protein Sequence
MYKRNGLMASVLVTSATPQGSSSSDSLEGQSCDYASKSYDAVVFDVLKVTPEEFASQITLMDIPVFKAIQPEELASCGWSKKEKHSLAPNVVAFTRRFNQVSFWVVREILTAQTLKIRAEILSHFVKIAKKLLELNNLHSLMSVVSALQSAPIFRLTKTWALLNRKDKTTFEKLDYLMSKEDNYKRTREYIRSLKMVPSIPYLGIYLLDLIYIDSAYPASGSIMENEQRSNQMNNILRIIADLQVSCSYDHLTTLPHVQKYLKSVRYIEELQKFVEDDNYKLSLRIEPGSSSPRLVSSKEDLAAM
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Isoform 4
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Amino acids 1-305 constitute the expression domain of recombinant Human RALGPS1. The calculated molecular weight for this RALGPS1 protein is 50.7 kDa. This protein is generated in a e.coli-based system. Fusion of the N-terminal 6xHis-SUMO tag into the RALGPS1 encoding gene fragment was conducted, allowing for easier detection and purification of the RALGPS1 protein in subsequent stages.
Human ras-specific guanine nucleotide-releasing factor RALGPS1 is a key regulator of the Ras small GTPases. RALGPS1 activates RalA and RalB, influencing cellular processes like vesicle trafficking, cell migration, and oncogenic transformation. In cancer research, RALGPS1 is implicated in tumor progression and metastasis, making it a potential therapeutic target. In cell biology, RALGPS1 is essential for understanding Ras signaling and intracellular dynamics. Additionally, RALGPS1 plays a role in synaptic transmission and neurodevelopment. Investigating RALGPS1 provides insights into molecular mechanisms of Ras activation, offering potential applications in cancer therapeutics, neurological research, and broader cell signaling studies, enhancing the understanding of cellular processes and diseases.
