Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

RALGPS1

Uniprot No.

Q5JS13

Research Area

Signal Transduction

Alternative Names

RALGPS1; KIAA0351; RALGEF2; Ras-specific guanine nucleotide-releasing factor RalGPS1; Ral GEF with PH domain and SH3-binding motif 1; Ral guanine nucleotide exchange factor 2; RalGEF 2; RalA exchange factor RalGPS1

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

1-305aa

Target Protein Sequence

MYKRNGLMASVLVTSATPQGSSSSDSLEGQSCDYASKSYDAVVFDVLKVTPEEFASQITLMDIPVFKAIQPEELASCGWSKKEKHSLAPNVVAFTRRFNQVSFWVVREILTAQTLKIRAEILSHFVKIAKKLLELNNLHSLMSVVSALQSAPIFRLTKTWALLNRKDKTTFEKLDYLMSKEDNYKRTREYIRSLKMVPSIPYLGIYLLDLIYIDSAYPASGSIMENEQRSNQMNNILRIIADLQVSCSYDHLTTLPHVQKYLKSVRYIEELQKFVEDDNYKLSLRIEPGSSSPRLVSSKEDLAAM
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

50.7kDa

Protein Length

Full Length of Isoform 4

Tag Info

N-terminal 6xHis-SUMO-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Amino acids 1-305 constitute the expression domain of recombinant Human RALGPS1. The calculated molecular weight for this RALGPS1 protein is 50.7 kDa. This protein is generated in a e.coli-based system. Fusion of the N-terminal 6xHis-SUMO tag into the RALGPS1 encoding gene fragment was conducted, allowing for easier detection and purification of the RALGPS1 protein in subsequent stages.

Human ras-specific guanine nucleotide-releasing factor RALGPS1 is a key regulator of the Ras small GTPases. RALGPS1 activates RalA and RalB, influencing cellular processes like vesicle trafficking, cell migration, and oncogenic transformation. In cancer research, RALGPS1 is implicated in tumor progression and metastasis, making it a potential therapeutic target. In cell biology, RALGPS1 is essential for understanding Ras signaling and intracellular dynamics. Additionally, RALGPS1 plays a role in synaptic transmission and neurodevelopment. Investigating RALGPS1 provides insights into molecular mechanisms of Ras activation, offering potential applications in cancer therapeutics, neurological research, and broader cell signaling studies, enhancing the understanding of cellular processes and diseases.

Target Background

Function

Guanine nucleotide exchange factor (GEF) for the small GTPase RALA. May be involved in cytoskeletal organization. Guanine nucleotide exchange factor for.

Gene References into Functions

The guanine-nucleotide exchange factor (GEF) RalGPS1a activates small GTPase Ral proteins such as RalA and RalB by stimulating the exchange of Ral bound GDP to GTP, thus regulating various downstream cellular processes. PMID: 21494904

Subcellular Location

Cytoplasm. Cell membrane. Note=Associates with membranes through the PH domain.

Tissue Specificity

Widely expressed (at protein level). Isoform 2 is expressed in brain, colon, kidney, pancreas, prostate, skeletal muscle, small intestine, testis, thymus and uterus. Isoform 1 is expressed at high levels in heart and testis and at lower levels in brain, p

Database Links

HGNC: 16851

OMIM: 614444

KEGG: hsa:9649

UniGene: Hs.432842

Code	CSB-EP683358HU
Abbreviation	Recombinant Human RALGPS1 protein
MSDS	MSDS Datasheet
Size	$224
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Ras-specific guanine nucleotide-releasing factor RalGPS1 (RALGPS1)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage