Recombinant Human Recoverin(RCVRN)

In Stock
Code CSB-YP019519HU
Product Type Recombinant Protein
Size US$2959Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. P35243
Lead Time 3-7 business days
Relevance Seems to be implicated in the pathway from retinal rod guanylate cyclase to rhodopsin. May be involved in the inhibition of the phosphorylation of rhodopsin in a calcium-dependent manner. The calcium-bound recoverin prolongs the photoresponse.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Cancer-associated retinopathy protein Short name: Protein CAR
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence GNSKSGALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQSIYAKFFPDTDPKAYAQHVFRSFDSNLDGTLDFKEYVIALHMTTAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVMAIFKMITPEDVKLLPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKMKNA
Research Area Neuroscience
Source Yeast
Gene Names RCVRN
Protein Names Recommended name: Recoverin Alternative name(s): Cancer-associated retinopathy protein Short name= Protein CAR
Expression Region 2-200aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 25.0kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Seems to be implicated in the pathway from retinal rod guanylate cyclase to rhodopsin. May be involved in the inhibition of the phosphorylation of rhodopsin in a calcium-dependent manner. The calcium-bound recoverin prolongs the photoresponse.
Protein Families Recoverin family
Tissue Specificity Retina and pineal gland.
Database Links

HGNC: 9937

OMIM: 179618

KEGG: hsa:5957

STRING: 9606.ENSP00000226193

UniGene: Hs.80539

Related Products

RCVRN Antibodies

RCVRN Antibodies for Homo sapiens (Human)

RCVRN Antibodies for Human

RCVRN Proteins

RCVRN Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.