Recombinant Human Relaxin receptor 2 (RXFP2), partial

In Stock
Code CSB-EP819908HU2
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
RXFP2
Uniprot No.
Research Area
Others
Alternative Names
(G-protein coupled receptor 106)(G-protein coupled receptor affecting testicular descent)(Leucine-rich repeat-containing G-protein coupled receptor 8)(Relaxin family peptide receptor 2)
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
33-158aa
Target Protein Sequence
FALTQGSMITPSCQKGYFPCGNLTKCLPRAFHCDGKDDCGNGADEENCGDTSGWATIFGTVHGNANSVALTQECFLKQYPQCCDCKETELECVNGDLKSVPMISNNVTLLSLKKNKIHSLPDKVFI
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
21.1 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The preparation of the recombinant Human RXFP2 protein involves manipulating the expression of the desired gene in e.coli cells. The sequence (33-158aa) of foreign DNA is fused to an expression vector and then introduced into e.coli cells. Selected positive cells are cultured to induce the expression of the desired protein. The protein features a N-terminal 10xHis tag and C-terminal Myc tag fusion. The recombinant targeted protein is subjected to affinity purification. Its purity exceeds 90% as assessed by SDS-PAGE.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for relaxin. The activity of this receptor is mediated by G proteins leading to stimulation of adenylate cyclase and an increase of cAMP. May also be a receptor for Leydig insulin-like peptide (INSL3).
Gene References into Functions
  1. In the TMD discovery cohort, sex-stratified analysis identified 2 additional genome-wide significant loci in females. One lying upstream of the relaxin/insulin-like family peptide receptor 2 ( RXP2) (chromosome 13, rs60249166,[OR] = 0.65, P = 3.6 x 10(-8)) was replicated among females in the meta-analysis (1-tailed P = 0.052). The other (chromosome 17, rs1531554, OR = 0.68, P = 2.9 x 10(-8)) was replicated among f PMID: 28081371
  2. Mapping key regions of the RXFP2 low-density lipoprotein class-A module that are involved in signal activation. PMID: 24983702
  3. Findings suggest a novel and gender-specific role for INSL3 and cognate receptor RXFP2 signaling in ocular surface homeostasis. PMID: 23539510
  4. haplotype analysis of the RXFP2 gene in T222P carriers and their parents showed that this variant is linked to the previously inferred C-C-G-A-13 haplotype and consequently provides further support to the 'founder effect' hypothesis PMID: 20636340
  5. higher expression of LGR8 may facilitate tumor invasiveness in the early clinical stage of hepatocellular carcinoma. PMID: 21789898
  6. Data show that synthetic parallel dimer of the B-chain of INSL3 is a potent inhibitor of the native peptide's binding to its receptor, RXFP2. PMID: 20560146
  7. the only clinical consequence of alterations of the INSL3-LGR8 system seems to be failure of the testis to normally descend in the scrotum during embryonic development, without affecting the spermatogenic and endocrine components of the testis itself PMID: 12970298
  8. mutations involving the human LGR8 gene do not represent a frequent cause of cryptorchidism in the Finnish population PMID: 14656401
  9. recurrent T222P mutation in the LGR8 gene was not found in any of the patients. These data show for the first time a lack of association between genetic factors necessary for correct testicular descent and anorchia. PMID: 15579790
  10. LGR8 signal is activated by the relaxin-like factor PMID: 15708846
  11. LGR8.1 spliced isoform is expressed at the cell surface, unable to stimulate cAMP production. PMID: 16051677
  12. Alanine-substituted analogs were used to identify the key residues of INSL3 that are responsible for the interaction with the ectodomain of LGR8. These include Arg(B16) and Val(B19), with His(B12) and Arg(B20) playing a secondary role. PMID: 16867980
  13. Novel allele of LGR8 (R223K) found in one patient with retractile testes. PMID: 16926383
  14. The V18M mutation in the insulin-like factor 3 signal peptide had a significant deleterious effect in activating LGR8 receptor in ex vivo studies PMID: 17437853
  15. predicted the complete INSL3/LGR8 primary binding site, including interactions between INSL3 His-B12 and LGR8 Trp-177, INSL3 Val-B19 and LGR8 Ile-179, and INSL3 Arg-B20 with LGR8 Asp-181 and Glu-229 PMID: 17473281
  16. negative cooperativity is present and that INSL3-RXFP2 binding shows both similarities and differences with insulin binding to the insulin receptor PMID: 18063691
  17. T222P mutation cannot be considered either causative or a susceptibility factor for cryptorchidism. PMID: 18073304
  18. No association between T222P/LGR8 mutation and cryptorchidism in the Moroccan population PMID: 18772597
  19. relaxin binds with high affinity to the leucine-rich repeats of RXFP2 in a manner similar to INSL3 binding to its receptor PMID: 19416162
  20. Several missense mutations were described in both the INSL3 and RXFP2 genes and a novel V39G INSL3 mutation in a patient with cryptorchidism was identified PMID: 19416188
  21. This study confirmed the association between INSL3 and RXFP2 gene mutations and human cryptorchidism. PMID: 19416190
  22. Data link RXFP2 gene mutations with human osteoporosis. PMID: 19416191

Show More

Hide All

Involvement in disease
Cryptorchidism (CRYPTO)
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Expressed mainly in the brain, kidney, muscle, testis, thyroid, uterus, peripheral blood cells and bone marrow.
Database Links

HGNC: 17318

OMIM: 219050

KEGG: hsa:122042

STRING: 9606.ENSP00000298386

UniGene: Hs.680763

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*