Recombinant Human SAM pointed domain-containing Ets transcription factor (SPDEF)

Code CSB-EP022518HU
Abbreviation Recombinant Human SPDEF protein
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Activity
Not Test
Target Names
SPDEF
Uniprot No.
Research Area
Cancer
Alternative Names
Prostate epithelium-specific Ets transcription factor;Prostate-derived Ets factor
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-335aa
Target Protein Sequence
MGSASPGLSSVSPSHLLLPPDTVSRTGLEKAAAGAVGLERRDWSPSPPATPEQGLSAFYLSYFDMLYPEDSSWAAKAPGASSREEPPEEPEQCPVIDSQAPAGSLDLVPGGLTLEEHSLEQVQSMVVGEVLKDIETACKLLNITADPMDWSPSNVQKWLLWTEHQYRLPPMGKAFQELAGKELCAMSEEQFRQRSPLGGDVLHAHLDIWKSAAWMKERTSPGAIHYCASTSEESWTDSEVDSSCSGQPIHLWQFLKELLLKPHSYGRFIRWLNKEKGIFKIEDSAQVARLWGIRKNRPAMNYDKLSRSIRQYYKKGIIRKPDISQRLVYQFVHPI
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
44.4 kDa
Protein Length
Full Length
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
May function as an androgen-independent transactivator of the prostate-specific antigen (PSA) promoter. Binds to 5'-GGAT-3' DNA sequences. May play a role in the regulation of the prostate gland and/or prostate cancer development. Acts as a transcriptional activator for SERPINB5 promoter.
Gene References into Functions
  1. PSMA, TERT, and PDEF may serve as a reference for clinical diagnosis and as potential targets for the malignant tumor of the prostate therapeutics PMID: 28829509
  2. This is, to our knowledge, the first report of decreased expression of TFF3, SPDEF, KLF4, and goblet cell population in the colon of patients with HSCR. Altered goblet cell function may result in intestinal barrier dysfunction contributing to the development of HAEC. PMID: 29383490
  3. Loss of SPDEF promotes prostate cancer growth and metastasis and can be caused by dysregulation or therapeutic inhibition of androgen receptor signaling. PMID: 28811384
  4. Results demonstrated that SPDEF expression is increased during IL-13-induced goblet cell differentiation, which correlates to hypermethylation of CpG number 8 in the SPDEF promoter. These findings suggest that aberrant DNA methylation of SPDEF is one of the factors underlying mucus hypersecretion in COPD. PMID: 28450970
  5. Taken together, these results suggested a novel function for SPDEF wherein it represses canonical Wnt/b-catenin transcriptional activity through selectively displacing b-catenin from chromatin targets. PMID: 28390865
  6. these findings demonstrate PDEF to be an oncogenic driver of breast cancer and a biomarker of poor prognosis in this cancer. Based on this understanding and the limited expression of PDEF in normal human tissues, the development of PDEF-based therapeutics for prevention and treatment of breast cancer is also discussed PMID: 28468594
  7. These results indicate efficient SPDEF silencing and downregulation of mucus-related gene expression by epigenetic editing, in human lung epithelial cells. PMID: 28011616
  8. miR-125b inhibits SPDEF expression modulating goblet cell differentiation and mucus secretion in asthma PMID: 27112664
  9. PDEF regulates many genes, which participate in various stages of tumor development. PMID: 27612480
  10. PDEF gene expression is associated with the extent of bladder neoplasia and PDEF modulated the expressions of EMT-related genes. PMID: 26965996
  11. SPDEF inhibits prostate carcinogenesis by disrupting a positive feedback loop in regulation of the Foxm1 oncogene. PMID: 25254494
  12. We found significantly increased SPDEF and MUC5AC expression in CRSwNP patients compared to the controls (P < .05); the mRNA level of SPDEF was positively correlated with MUC5AC expression in CRS patients (P < .05). PMID: 25376946
  13. we identified four proteins with different expression in paclitaxel resistant cells, i.e., serpin B3, serpin B4, heat shock protein 27 (all three upregulated) and cytokeratin 18 (downregulated). PMID: 24898171
  14. PDEF undergoes DNA methylation in breast cancer cells. PMID: 23921628
  15. Host Kruppel-like factor 15, Slug, and SPDEF, stimulated the herpes simplex virus type 1 ICP0 promoter more than 150-fold. PMID: 24027338
  16. Data indicate that Il-9 and IL-13 regulate expressions of MUC5AC, SPDEF and matrix metalloproteinase 7 (MMP-7) in pediatric bronchial epithelial cell. PMID: 23671562
  17. these findings show that PDEF-CEACAM6 is a highly active oncogenic axis in breast cancer PMID: 23592399
  18. Data demonstrate that SPDEF is required for conjunctival goblet cell differentiation and down-regulation of SPDEF may play a role in human dry eye with goblet cell loss. PMID: 23665202
  19. Prostate-derived ETS factor (PDEF) is identified as a mediator of mammary luminal epithelial lineage-specific gene expression and as a factor required for tumorigenesis in a subset of breast cancers. PMID: 23764000
  20. In colorectal tumors from patients, loss of SPDEF was observed in approximately 85% of tumors and correlated with progression from normal tissue, to adenoma, to adenocarcinoma. PMID: 23376423
  21. Data show that SAM pointed domain ETS factor (SPDEF) was induced by rhinoviral infection of primary human airway cells. PMID: 23012424
  22. SPDEF functions as a tumor metastasis suppressor in vivo. PMID: 22761428
  23. PDEF may inhibit prostate cancer progression by transcriptional downregulation of oncogenic STMN expression. PMID: 22378487
  24. PDEF is a negative regulator of prostate tumor progression and the miR-204-PDEF regulatory axis contributes to PDEF protein loss and resultant cancer progression. PMID: 21446014
  25. Studies indicate that PDEF is a negative regulator of tumor progression and metastasis. PMID: 21764212
  26. Up-regulation of PDEF is associated with a favorable prognosis in patients with clinically localized prostate cancer. PMID: 21656828
  27. results show that SPDEF plays a critical role in regulating a transcriptional network mediating IL-13-induced MUC5AC synthesis dependent on STAT6 PMID: 21275604
  28. studies demonstrate for the first time negative regulation of MMP9 expression by PDEF, and that PDEF expression was lost in aggressive prostate cancer and was inversely associated with MMP9 expression in clinical samples of prostate cancer PMID: 20550708
  29. Transcriptional regulation of p21/CIP1 cell cycle inhibitor by PDEF controls cell proliferation and mammary tumor progression PMID: 20139077
  30. PDEF is a negative regulator of colon cancer cell growth and migration. PMID: 19830706
  31. Spdef was sufficient to inhibit proliferation of intestinal progenitors and induce differentiation into goblet cells. PMID: 19786015
  32. NKX-3.1 interacts with prostate-derived Ets factor and regulates the activity of the PSA promoter. PMID: 11809674
  33. PDEF upregulates p62 promoter activity at 2 sites. PSI downregulates PDEF-induced p62 promoter activation through one of these sites. PMID: 12700667
  34. Pdef loss may alter the expression of genes controlling progression to invasive breast cancer. PMID: 12907642
  35. identified novel protein-protein interaction domains within NKX-3.1 and PDEF that operate in concert with their respective DNA binding domains to mediate functional interactions between these growth regulatory transcription factors PMID: 15523673
  36. Despite common essential features that are shared among Ets members, the crystal structure of PDEF Ets domain demonstrates distinct patterns of interactions at different positions of DNA in achieving sequence specific recognition. PMID: 15882048
  37. RUNX factors participate in prostate epithelial cell function and cooperate with an Ets transcription factor to regulate PSA gene expression PMID: 16237704
  38. PDEF overexpression is associated with activation of ErbB2 and CSF-1R and breast tumor progression PMID: 16357167
  39. prostate-derived Ets factor is a potential marker and target in ovarian cancer PMID: 17197890
  40. SPDEF was induced following intratracheal allergen exposure and after Th2 cytokine stimulation and was sufficient to cause goblet cell differentiation of Clara cells in vivo. PMID: 17347682
  41. these results for the first time show frequent increased expression of PDEF protein in breast and prostate tumors and support a role for PDEF in breast and prostate cancer progression. PMID: 17521701
  42. PDEF mRNA expression could be useful in breast cancer molecular staging. PMID: 17971898
  43. increased PDEF expression along with reduced survivin was associated with prolonged survival of patients with ovarian cancer PMID: 18567002
  44. analysis of PDEF transcriptional networks regulating cell migration during cancer progression PMID: 18579687
  45. prostate derived Ets factor mRNA quantitation did not reveal any significant differences between breast cancer patients and healthy women PMID: 18846421
  46. PDEF may be regulated by Erbb2 or EGFR-activated signaling pathways in breast cancer cells. PMID: 19203193
  47. we hypothesize that SPDEF has a function in the specification of the progenitor cells of the luminal epithelial lineage that become targets of oncogenesis in luminal breast cancer. PMID: 19505923

Show More

Hide All

Subcellular Location
Nucleus.
Protein Families
ETS family
Tissue Specificity
Expressed in a very restricted set of primarily hormone-regulated epithelial tissues with particularly high expression in the prostate gland. Significantly lower expression is seen in other hormone regulated tissues such as mammary gland, salivary gland,
Database Links

HGNC: 17257

OMIM: 608144

KEGG: hsa:25803

STRING: 9606.ENSP00000363149

UniGene: Hs.485158

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*