Recombinant Human Sal-like protein 4 (SALL4), partial

In Stock
Code CSB-BP892126HU(M)
MSDS
Size $528
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
SALL4
Uniprot No.
Research Area
Developmental Biology
Alternative Names
AA407717; AL022809; AW536104; C330011P20Rik; C78083; C78563; dJ1112F19.1; DRRS; HSAL4; Sal like 4 (Drosophila); Sal like 4; Sal like Protein 4; Sal-like protein 4; Sall4; SALL4_HUMAN; Spalt like transcription factor 4; Tex20; Zinc finger protein 797; Zinc finger protein SALL4; ZNF797
Species
Homo sapiens (Human)
Source
Baculovirus
Expression Region
954-1053aa+11R
Target Protein Sequence
PKEILAPSVNVDPVVWNQYTSMLNGGLAVKTNEISVIQSGGVPTLPVSLGATSVVNNATVSKMDGSQSGISADVEKPSATDGVPKHQFPHFLEENKIAVS
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
16
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Insertion of the gene encoding the Human SALL4 protein (954-1053aa+11R) into a plasmid vector results in the formation of recombinant plasmid, which is then introduced into baculovirus cells. Positive baculovirus cells are selected relying on their ability to survive in the presence of a specific antibiotic. The baculovirus cells containing the recombinant plasmid are cultured under conditions conducive to the expression of the gene of interest. A N-terminal 10xHis tag and C-terminal Myc tag is attached to the protein. Following expression, the recombinant Human SALL4 protein is isolated and purified from the cell lysate through affinity purification. The resultant recombinant Human SALL4 protein is analyzed using denaturing SDS-PAGE, revealing a purity greater than 85%.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Transcription factor with a key role in the maintenance and self-renewal of embryonic and hematopoietic stem cells.
Gene References into Functions
  1. an HBV-pSTAT3-SALL4-miR-200c axis regulates PD-L1 causing T cell exhaustion PMID: 29593314
  2. the TRIM21 knockdown increases SALL1 levels, indicating that TRIM21 degrades both SALL1 and SALL4. PMID: 29511085
  3. These data indicate that aberrantly expressed SALL4 in human choriocarcinoma cells may promote cell proliferation via beta-catenin/c-Myc pathway PMID: 28639477
  4. SALL4 was significantly upregulated in glioma tissues and cell lines, and an inverse correlation between miR-98 and SALL4 expression in glioma tissues was identified. PMID: 29436585
  5. TNFSF13, SPATC1L, SLC22A25 and SALL4 may thus be novel susceptibility loci for atrial fibrillation in the Japanese population PMID: 28849223
  6. Study showed significantly high expression of SALL4 mRNA in glioma specimens as compared to non-tumor samples using RT-PCR. Blocking SALL4 using SALL4-siRNA decreased proliferation of U87 and U251 cells, which was reversed by the addition of PTEN inhibitor phen (bpv). Furthermore, marked increase in PTEN mRNA and protein levels was seen in cells treated with siRNA-SALL4. PMID: 28887597
  7. SALL4 is a promising prognostic biomarker for cancer, and is appropriate for the assessment of cancer prognosis in the Chinese people. PMID: 28582841
  8. Our experimental data indicated that over expression of SALL4 was found in CRC and low expression of SALL4 was connected with high survival rate after surgery. Thus our study suggested that SALL4 could serve as a potential diagnostic and prognostic marker of CRC. PMID: 28869451
  9. SALL4 is a target gene of miR-181b in glioma.SALL4 is upregulated in glioma. PMID: 27938503
  10. SALL4 is a target gene of mir-98 in non-small cell lung cancer cells. PMID: 27938506
  11. miR-98 plays a suppressive role in the proliferation, migration, invasion and EMT of HCC cells, partly at least, via directly inhibition of SALL4. PMID: 27677076
  12. SALL4 immunopositivity is not a prognostic factor in Combined hepatocellular carcinoma (HCC) and cholangiocarcinoma (CC) (cHCC-CC); however, it is associated with alpha-fetoprotein, glypican 3 and EpCAM immunopositivity, indicating the mechanism of carcinogenesis. PMID: 26267070
  13. these data suggest that Bmi-1 could serve as a novel prognostic biomarker in pediatric primary acute lymphoblastic leukemia (ALL)and may be partially regulated by Sall4a. Our study also showed that Bmi-1 could serve as a new therapeutic target for the treatment of pediatric ALL. PMID: 28122538
  14. SALL4 overexpression is associated with neoplasms. PMID: 27007163
  15. Findings indicate that long-term exposure to IM results in dysregulation of stem cell renewal-regulatory Hippo (MST1/2)/YAP signaling, and that inhibition of miR-181a using a microRNA sponge inhibitor resulted in decreased transcription of SOX2 and SALL4. PMID: 28103766
  16. Study showed that SALL4 was overexpressed in a majority of human esophageal squamous cell carcinoma (ESCC) tissues and that aberrantly activated SALL4 may contribute to esophageal tumorigenesis by promoting malignant proliferation and inhibiting cell apoptosis, regulating esophageal squamous cell migration, invasion and cell cycle. PMID: 27329034
  17. Data show that SALL4 promotes the expression of Glut1 and open chromatin through a HP1alpha-dependent mechanism. PMID: 28759035
  18. Our report is the first description of structural eye defects associated with two missense variants in SALL4 inherited in trans; the absence of reported findings in both parents suggests that both sequence variants are hypomorphic mutations and that both are needed for the ocular phenotype. PMID: 27661448
  19. our study showed that SALL4 plays an important role in regulating the proliferation, migration, and invasion of osteosarcoma cells. PMID: 27983924
  20. The SALL4 - integrin alpha6 - integrin beta1 network promotes cell migration for metastasis via activation of focal adhesion dynamics in basal-like breast cancer cells. PMID: 27773610
  21. Coexpression of SALL4 with HDAC1 and/or HDAC2 was associated with PTEN underexpression and a poor prognosis in hepatocellular carcinoma. PMID: 28411180
  22. SALL4 has a negative impact in DNA damage repair, and support the model of dual functional properties of SALL4 in leukemogenesis through inhibiting DNA damage repair and promoting cell survival. PMID: 27132514
  23. demethylation of CpGs located within OCT4 and STAT3 cis-acting elements, downstream of SALL4 TSS, enables OCT4 and STAT3 binding, recruitment of BRG1, and enhanced RNA polymerase II elongation and SALL4 transcription PMID: 27797380
  24. SALL4 was expressed in 100% of choriocarcinomas and it was not detected in any placental site trophoblastic tumor and epithelioid trophoblastic tumor. PMID: 27068524
  25. SALL4 is useful for subtyping hepatoblastoma, and high SALL4 expression is associated with decreased survival in hepatoblastoma. PMID: 27252091
  26. expression detected in 36% of undifferentiated/dedifferentiated endometrial carcinomas, not other in high-grade endometrial carcinomas PMID: 28272224
  27. miR33b suppresses the proliferation and metastasis of hepatocellular carcinoma cells through the inhibition of SALL4 expression. PMID: 28026002
  28. this study demonstrates that miR-16 plays a suppressive role in regulating cell proliferation, migration and invasion, and EMT in glioma, at least in part by directly targeting SALL4. PMID: 27748823
  29. We evaluate the effects of siRNA-inhibited expression of the SALL4 gene on the proliferation, colony formation, and apoptosis of prostate cancer C4-2 cells. Silencing SALL4 expression by using siRNA technology inhibited the proliferation and colony formation of C4-2 cells, and promoted apoptosis likely mediated by Bcl-2 and Bax expression. PMID: 27323021
  30. the under-expression of SOX1 was associated significantly with SALL4 overexpression. This study was the first to evaluate SOX1 underexpression and its association with poor prognosis in esophageal squamous cell carcinoma. PMID: 27576349
  31. Hepatocellular carcinoma patients with higher expression levels of SALL4 and AFP have worse prognosis. PMID: 26973422
  32. Persistent expression of SALL4 in metastatic MGCTs resistant to chemoradiation also raises the possibility for targeted systemic therapy as the anti-SALL4 peptide continues to be developed PMID: 25906119
  33. SALL4 and beta-catenin were positively correlated in colorectal cancer. PMID: 26779651
  34. SALL4 was highly expressed and correlated with poor prognosis in SOC patients, promoting invasion and metastasis of OC cells. PMID: 26750614
  35. Study reports a novel heterozygous frameshift insertion in SALL4, c.410dupG (p.Gly138Argfs*43) segregating with Okihiro syndrome in a Brazilian pedigree with five affected individuals; the c.410dupG variant in SALL4 gene reported here is the cause of Okihiro syndrome without Duane anomaly, but with foot defect in one affected individual. PMID: 26791099
  36. By inhibition of SALL4 expression, the proliferation, invasiveness and drug resistance were dramatically reduced while apoptosis rate was up-regulated. PMID: 26617716
  37. SALL4 expression in squamous cell carcinoma of the esophagus may constitute a sign of dedifferentiation leading to poor patient prognosis PMID: 26818834
  38. SALL4 has an oncogenic role in intrahepatic cholangiocarcinoma PMID: 26317546
  39. review aims to summarize our current knowledge of SALL4, including a SALL4-based approach to classify and target cancers PMID: 26892498
  40. SALL4 could induce Epithelial-mesenchymal transition and resistance to antineoplastic drugs through the regulation of c-Myc. SALL4 and c-Myc may be novel therapeutic targets for endometrial cancer. PMID: 26407074
  41. The results show that miR-219-5p inhibited carcinogenesis of colon cancer by targeting oncogene Sall4 PMID: 26238082
  42. identifies the KRLR sequence as a bona fide nuclear localization signal for SALL4B. PMID: 24626181
  43. An atypical 0.73 MB microduplication of 22q11.21 and a novel SALL4 missense mutation associated with thumb agenesis and radioulnar synostosis. PMID: 25823593
  44. The mechanism through which miR-33b inhibits the stemness, migration and invasion of breast cancer cells is by targeting HMGA2, SALL4 and Twist1. PMID: 25919570
  45. Results indicate that SALL4 overexpression acts as a natural resistance factor and may be involved in the recurrence of lung cancer after adjuvant chemotherapy. PMID: 25646965
  46. Results indicated that the SALL4 may play an important role in progression, development and maintenance of glioma PMID: 25359397
  47. Despite moderate sensitivity, SALL4 expression may aid in distinguishing Malignant rhabdoid tumours from epithelioid sarcomas PMID: 24827994
  48. Aberrant SALL4 expression has been found in nearly all AML cases, whereas, in normal bone marrow and peripheral blood cells, its expression is only restricted to hematopoietic stem/progenitor cells. PMID: 25737450
  49. the evaluation of ERG and SALL4 immunoexpressions may be a useful diagnostic tool to distinguish epithelioid sarcoma, especially proximal type, from malignant rhabdoid tumor PMID: 25479928
  50. SALL4 has functional roles in metastasis and drug resistance in aggressive endometrial cancer PMID: 24336327

Show More

Hide All

Involvement in disease
Duane-radial ray syndrome (DRRS); Oculootoradial syndrome (OORS)
Subcellular Location
Cytoplasm. Nucleus.
Protein Families
Sal C2H2-type zinc-finger protein family
Tissue Specificity
Expressed in testis. Constitutively expressed in acute myeloid leukemia (AML).
Database Links

HGNC: 15924

OMIM: 147750

KEGG: hsa:57167

STRING: 9606.ENSP00000217086

UniGene: Hs.517113

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*