Recombinant Human Secreted Ly-6/uPAR-related protein 1(SLURP1)

Code CSB-YP021784HU
Product Type Recombinant Protein
Size US$2959
Uniprot No. P55000
Relevance Has an antitumor activity. Was found to be a marker of late differentiation of the skin. Implicated in maintaining the physiological and structural integrity of the keratinocyte layers of the skin.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence LKCYTCKEPMTSASCRTITRCKPEDTACMTTLVTVEAEYPFNQSPVVTRSCSSSCVATDPDSIGAAHLIFCCFRDLCNSEL
Research Area Cardiovascular
Source Yeast
Gene Names SLURP1
Protein Names ARS component B ARS(component B)-81/S Anti-neoplastic urinary protein Short name: ANUP
Expression Region 23-103aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 10.9 kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Has an antitumor activity
Involvement in disease Mal de Meleda (MDM)
Subcellular Location Secreted
Tissue Specificity Granulocytes. Expressed in skin. Predominantly expressed in the granular layer of skin, notably the acrosyringium. Identified in several biological fluids such as sweat, saliva, tears, plasma and urine.
Database Links

HGNC: 18746

OMIM: 248300

KEGG: hsa:57152

STRING: 9606.ENSP00000246515

UniGene: Hs.103505

Related Products

SLURP1 Antibodies

SLURP1 Antibodies for Human

SLURP1 Antibodies for Homo sapiens (Human)

SLURP1 Proteins

SLURP1 Proteins for Homo sapiens (Human)

SLURP1 ELISA Kit

SLURP1 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.