Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

CHGB

Uniprot No.

P05060

Research Area

Neuroscience

Alternative Names

(Chromogranin-B)(CgB)(Secretogranin I)(SgI)

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

328-677aa

Target Protein Sequence

HSTHYRASEEEPEYGEEIKGYPGVQAPEDLEWERYRGRGSEEYRAPRPQSEESWDEEDKRNYPSLELDKMAHGYGEESEEERGLEPGKGRHHRGRGGEPRAYFMSDTREEKRFLGEGHHRVQENQMDKARRHPQGAWKELDRNYLNYGEEGAPGKWQQQGDLQDTKENREEARFQDKQYSSHHTAEKRKRLGELFNPYYDPLQWKSSHFERRDNMNDNFLEGEEENELTLNEKNFFPEYNYDWWEKKPFSEDVNWGYEKRNLARVPKLDLKRQYDRVAQLDQLLHYRKKSAEFPDFYDSEEPVSTHQEAENEKDRADQTVLTEDEKKELENLAAMDLELQKIAEKFSQRG
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

73.5 kDa

Protein Length

Partial

Tag Info

N-terminal 6xHis-GST-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Recombinant Human CHGB protein expression is initiated by transfecting e.coli cells with a DNA expression vector containing the gene encoding the protein of interest (328-677aa). The subsequent culturing of the cells induces the expression of the desired protein. The protein is equipped with a N-terminal 6xHis-GST tag. The resulting recombinant Human CHGB protein is collected and purified from the cell lysate through affinity purification, demonstrating a purity greater than 85%, as indicated by SDS-PAGE.

Target Background

Function

Secretogranin-1 is a neuroendocrine secretory granule protein, which may be the precursor for other biologically active peptides.

Gene References into Functions

evidence suggests that the P413L variant of chromogranin B is not associated with amyotrophic lateral sclerosis (ALS) risk or age at ALS onset (meta-analysis). PMID: 28795874
Data suggest that chromogranin B (CGB) is a promising emerging biomarker in heart failure (HF) patients with unique potential to integrate information from myocardial stress and neuro-endocrine activation. PMID: 29098879
Circulating chromogranin B (CgB) levels measured on Intensive Care Unit (ICU) admission provided additional prognostic information to established risk indices in acute respiratory failure (ARF) patients. PMID: 28049363
results presented here suggest that CHGB variant alleles, the rare CHGB-L413 and common CHGB-P413, may act as modifiers of ALS disease dependent on their expression levels which is higher in females because of a sex-determining region Y element in the CHGB gene promoter. PMID: 28175304
our results suggest that genetic variants of CHGB may have sex-specific effects on the risk of schizophrenia and provide useful preliminary information for further study. PMID: 28332369
intracellular calcium binding protein Sg1 is increased in early multiple sclerosis (MS) patients compared to relapsing-remitting MS and neurological controls. PMID: 26152395
The polymorphism P413L in the CHGB gene was not associated with sporadic amyotrophic lateral sclerosis in a group of Italian patients. PMID: 26003296
A heterogeneous response to short- and long-term physical activities among circulating granin proteins, particularly chromogranin B. PMID: 23816467
Results do not support the 413L variant of chromogranin B as a risk factor for sporadic amyotrophic lateral sclerosis in the French population. PMID: 20932227
common polymorphism in the 3'-UTR (C+84A) of CHGB, which disrupts an A/U-rich messenger ribonucleic acid stability element, associates with not only CHGB secretion but also excretion of isoprostane PMID: 20888525
The common CHGB promoter variants A-296C and A-261T, and their consequent haplotypes, alter binding of specific transcription factors to influence gene expression in cella as well as BP in vivo PMID: 20359597
Genetic variation at the CHGB locus, in the proximal promoter, influences CHGB expression as well as catecholamine secretion and later the early heritable responses to environmental stress, and resting/basal Blood Pressure in the population. PMID: 20011129
finding that CHGB may act as a susceptibility gene and modifier of onset in ALS is consistent with the emerging view that dysfunction of the secretory pathway may contribute to increased vulnerability of motor neurons PMID: 20007371
Chromogranin B was selected as a candidate gene for schizophrenia. We systematically screened all the promoter and exon regions of the gene and detected 15 single nucleotide polymorphisms in a Chinese population. PMID: 11959426
CgB may play some role in the early phase of neoplastic progression PMID: 12165659
there are four different types of chromogranin B in pancreatic islets as demonstrated by region-specific antibodies PMID: 12438147
5 CgB fragments were measured in plasma: CgB1-16, CgB312-331, CgB439-451, CgB568-577, & CgB647-657. Substantial heritability, as measured by h2r, was observed for 3 of the fragment concentrations, CgB312-331, CgB439-451, and CgB568-577. PMID: 15138309
10 microsatellite markers were analyzed, and an association of schizophrenia was found with D20S882 and D20S905 that flank D20S95. The chromogranin B gene is 30 kb from D20S905. PMID: 15219467
Overall, our results suggest that at least one locus in or close to the CHGB gene confers risk of the disorder and strengthen the evidence that CHGB is a promising susceptibility gene for schizophrenia in Chinese population. PMID: 17143778
Locally infused tyramine produced dose-dependent pressor responses, predicted by family history of hypertension, sex, and genetic variants at loci, particularly CHGB, that encode the biosynthesis, storage, and metabolism of catecholamines. PMID: 18180394
semiquantitative immunocytochemistry for chromogranin B in amyotrophic lateral sclerosis PMID: 18721831

Hide All

Subcellular Location

Secreted. Note=Neuroendocrine and endocrine secretory granules.

Protein Families

Chromogranin/secretogranin protein family

Tissue Specificity

Expressed in the adrenal medulla, and in pheochromocytoma. Not expressed in liver.

Database Links

HGNC: 1930

OMIM: 118920

KEGG: hsa:1114

STRING: 9606.ENSP00000368244

UniGene: Hs.516874

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：
If CAPTCHA verification fails, click to refresh the CAPTCHA and try again.

Code	CSB-EP005345HU1
Abbreviation	Recombinant Human CHGB protein, partial
MSDS	MSDS Datasheet
Size	$256
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Secretogranin-1 (CHGB), partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage