Recombinant Human Secretogranin-1 (CHGB), partial

In Stock
Code CSB-EP005345HU1
Abbreviation Recombinant Human CHGB protein, partial
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
CHGB
Uniprot No.
Research Area
Neuroscience
Alternative Names
(Chromogranin-B)(CgB)(Secretogranin I)(SgI)
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
328-677aa
Target Protein Sequence
HSTHYRASEEEPEYGEEIKGYPGVQAPEDLEWERYRGRGSEEYRAPRPQSEESWDEEDKRNYPSLELDKMAHGYGEESEEERGLEPGKGRHHRGRGGEPRAYFMSDTREEKRFLGEGHHRVQENQMDKARRHPQGAWKELDRNYLNYGEEGAPGKWQQQGDLQDTKENREEARFQDKQYSSHHTAEKRKRLGELFNPYYDPLQWKSSHFERRDNMNDNFLEGEEENELTLNEKNFFPEYNYDWWEKKPFSEDVNWGYEKRNLARVPKLDLKRQYDRVAQLDQLLHYRKKSAEFPDFYDSEEPVSTHQEAENEKDRADQTVLTEDEKKELENLAAMDLELQKIAEKFSQRG
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
73.5 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human CHGB protein expression is initiated by transfecting e.coli cells with a DNA expression vector containing the gene encoding the protein of interest (328-677aa). The subsequent culturing of the cells induces the expression of the desired protein. The protein is equipped with a N-terminal 6xHis-GST tag. The resulting recombinant Human CHGB protein is collected and purified from the cell lysate through affinity purification, demonstrating a purity greater than 85%, as indicated by SDS-PAGE.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Secretogranin-1 is a neuroendocrine secretory granule protein, which may be the precursor for other biologically active peptides.
Gene References into Functions
  1. evidence suggests that the P413L variant of chromogranin B is not associated with amyotrophic lateral sclerosis (ALS) risk or age at ALS onset (meta-analysis). PMID: 28795874
  2. Data suggest that chromogranin B (CGB) is a promising emerging biomarker in heart failure (HF) patients with unique potential to integrate information from myocardial stress and neuro-endocrine activation. PMID: 29098879
  3. Circulating chromogranin B (CgB) levels measured on Intensive Care Unit (ICU) admission provided additional prognostic information to established risk indices in acute respiratory failure (ARF) patients. PMID: 28049363
  4. results presented here suggest that CHGB variant alleles, the rare CHGB-L413 and common CHGB-P413, may act as modifiers of ALS disease dependent on their expression levels which is higher in females because of a sex-determining region Y element in the CHGB gene promoter. PMID: 28175304
  5. our results suggest that genetic variants of CHGB may have sex-specific effects on the risk of schizophrenia and provide useful preliminary information for further study. PMID: 28332369
  6. intracellular calcium binding protein Sg1 is increased in early multiple sclerosis (MS) patients compared to relapsing-remitting MS and neurological controls. PMID: 26152395
  7. The polymorphism P413L in the CHGB gene was not associated with sporadic amyotrophic lateral sclerosis in a group of Italian patients. PMID: 26003296
  8. A heterogeneous response to short- and long-term physical activities among circulating granin proteins, particularly chromogranin B. PMID: 23816467
  9. Results do not support the 413L variant of chromogranin B as a risk factor for sporadic amyotrophic lateral sclerosis in the French population. PMID: 20932227
  10. common polymorphism in the 3'-UTR (C+84A) of CHGB, which disrupts an A/U-rich messenger ribonucleic acid stability element, associates with not only CHGB secretion but also excretion of isoprostane PMID: 20888525
  11. The common CHGB promoter variants A-296C and A-261T, and their consequent haplotypes, alter binding of specific transcription factors to influence gene expression in cella as well as BP in vivo PMID: 20359597
  12. Genetic variation at the CHGB locus, in the proximal promoter, influences CHGB expression as well as catecholamine secretion and later the early heritable responses to environmental stress, and resting/basal Blood Pressure in the population. PMID: 20011129
  13. finding that CHGB may act as a susceptibility gene and modifier of onset in ALS is consistent with the emerging view that dysfunction of the secretory pathway may contribute to increased vulnerability of motor neurons PMID: 20007371
  14. Chromogranin B was selected as a candidate gene for schizophrenia. We systematically screened all the promoter and exon regions of the gene and detected 15 single nucleotide polymorphisms in a Chinese population. PMID: 11959426
  15. CgB may play some role in the early phase of neoplastic progression PMID: 12165659
  16. there are four different types of chromogranin B in pancreatic islets as demonstrated by region-specific antibodies PMID: 12438147
  17. 5 CgB fragments were measured in plasma: CgB1-16, CgB312-331, CgB439-451, CgB568-577, & CgB647-657. Substantial heritability, as measured by h2r, was observed for 3 of the fragment concentrations, CgB312-331, CgB439-451, and CgB568-577. PMID: 15138309
  18. 10 microsatellite markers were analyzed, and an association of schizophrenia was found with D20S882 and D20S905 that flank D20S95. The chromogranin B gene is 30 kb from D20S905. PMID: 15219467
  19. Overall, our results suggest that at least one locus in or close to the CHGB gene confers risk of the disorder and strengthen the evidence that CHGB is a promising susceptibility gene for schizophrenia in Chinese population. PMID: 17143778
  20. Locally infused tyramine produced dose-dependent pressor responses, predicted by family history of hypertension, sex, and genetic variants at loci, particularly CHGB, that encode the biosynthesis, storage, and metabolism of catecholamines. PMID: 18180394
  21. semiquantitative immunocytochemistry for chromogranin B in amyotrophic lateral sclerosis PMID: 18721831

Show More

Hide All

Subcellular Location
Secreted. Note=Neuroendocrine and endocrine secretory granules.
Protein Families
Chromogranin/secretogranin protein family
Tissue Specificity
Expressed in the adrenal medulla, and in pheochromocytoma. Not expressed in liver.
Database Links

HGNC: 1930

OMIM: 118920

KEGG: hsa:1114

STRING: 9606.ENSP00000368244

UniGene: Hs.516874

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*