Recombinant Human Secretogranin-2 (SCG2), partial

In Stock
Code CSB-EP020808HU1
Abbreviation Recombinant Human SCG2 protein, partial
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
SCG2
Uniprot No.
Research Area
Neuroscience
Alternative Names
Chromogranin-C;Secretogranin II;SgII;Secretoneurin;SN;Manserin
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
418-617aa
Target Protein Sequence
TPGRAGTEALPDGLSVEDILNLLGMESAANQKTSYFPNPYNQEKVLPRLPYGAGRSRSNQLPKAAWIPHVENRQMAYENLNDKDQELGEYLARMLVKYPEIINSNQVKRVPGQGSSEDDLQEEEQIEQAIKEHLNQGSSQETDKLAPVSKRFPVGPPKNDDTPNRQYWDEDLLMKVLEYLNQEKAEKGREHIAKRAMENM
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
54.3 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Neuroendocrine protein of the granin family that regulates the biogenesis of secretory granules.
Gene References into Functions
  1. Differential Reovirus-Specific and Herpesvirus-Specific Activator Protein 1 Activation of Secretogranin II Leads to Altered Virus Secretion. PMID: 26378181
  2. present data show that SgII is highly expressed in advanced prostate cancer and may contribute to the neuroendocrine differentiation by promoting the formation of secretory granules and the proliferation of PCa cells. PMID: 25307750
  3. SN induces MUC5AC hypersecretion in a dose- and time-dependent manner; moreover, the MUC5AC over synthesis induced by SN is strongly associated with the enhanced binding of EGF to NRP1 PMID: 24556756
  4. Topical secretoneurin gene therapy accelerates diabetic wound healing by interaction between heparan-sulfate proteoglycans and basic FGF. PMID: 23918206
  5. Manserin may serve as a marker of prostate cancer progression. PMID: 21803620
  6. CgA, CgB, and secretoneurin are detectable in feces, and collagenous colitis patients express higher values than patients with inflammatory bowel disease and controls. In treatment, fecal secretoneurin decreased to control levels in collagenous colitis. PMID: 23423580
  7. In vivo secretoneurin improves left ventricular function, inhibits remodeling, and reduces scar formation; in the infarct border zone, secretoneurin induces coronary angiogenesis. PMID: 23081990
  8. Circulating Levels of SgII are Increased in Patients with chronic, stable heart failure. PMID: 22655045
  9. Data describe the gene expression and protein production of SgII in normal adrenal glands and pheochromocytomas with the goal to examine the molecular mechanisms leading to the marked variations in the expression of EM66 in tumoral chromaffin tissue. PMID: 22217803
  10. This short review deals with investigations in neuroendocrine tumors (NETs) with antibodies against defined epitopes of chromogranins (Cgs) A and B and secretogranins (Sgs) II and III. PMID: 21046454
  11. More SgII immunoreactive cells were observed in phaeochromocytomas. PMID: 20550951
  12. Transendothelial migration of leukocytes and signalling mechanisms in response to the neuropeptide secretoneurin. PMID: 11853870
  13. secretogranin II-derived peptide EM66 generated in human tumoral chromaffin tissue; significant difference in EM66 concentrations between benign and malignant pheochromocytomas PMID: 12788858
  14. the high concentration of secretoneurin in the aqueous humor indicates a significant role of this peptide PMID: 15572199
  15. a variant of Secretogranin II has a role in regulation by PHOX2 transcription factors and in hypertension PMID: 17584765
  16. Results suggest that secretogranin II represents a key AP-1-regulated protein that counteracts nitric oxide toxicity and mediates neuronal differentiation of neuroblastoma cells. PMID: 18239671
  17. Increased concentrations of SgII, especially the N-terminal part of secretoneurin could be measured in plasma from patients with endocrine pancreatic tumours. PMID: 18448176
  18. Suppression of Pdcd4 resulted in an increased release of CgA and Sg II and was accompanied by an up-regulation of intracellular PC1. PMID: 18549351
  19. semiquantitative immunocytochemistry for secretogranin II in amyotrophic lateral sclerosis. PMID: 18721831

Show More

Hide All

Subcellular Location
Secreted. Note=Neuroendocrine and endocrine secretory granules.
Protein Families
Chromogranin/secretogranin protein family
Database Links

HGNC: 10575

OMIM: 118930

KEGG: hsa:7857

STRING: 9606.ENSP00000304133

UniGene: Hs.516726

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*