Home
Protein
Recombinant Protein
Recombinant Human Serine/arginine repetitive matrix protein 2 (SRRM2), partial

Recombinant Human Serine/arginine repetitive matrix protein 2 (SRRM2), partial

^{In Stock}

Code	CSB-BP892369HU
MSDS	MSDS
Size	$528
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

SRRM2

Uniprot No.

Q9UQ35

Research Area

Others

Alternative Names

300 kDa nuclear matrix antigen; CWC21; KIAA0324; Ser/Arg-related nuclear matrix protein of 300 kDa; Serine/arginine repetitive matrix protein 2; Serine/arginine-rich splicing factor-related nuclear matrix protein of 300 kDa; Splicing coactivator subunit SRm300; SR-related nuclear matrix protein of 300 kDa; SRL300; SRM300; SRRM2; SRRM2_HUMAN; Tax-responsive enhancer element-binding protein 803; TaxREB803

Species

Homo sapiens (Human)

Source

Baculovirus

Expression Region

1666-2089aa

Target Protein Sequence

RTARRGSRSSPEPKTKSRTPPRRRSSRSSPELTRKARLSRRSRSASSSPETRSRTPPRHRRSPSVSSPEPAEKSRSSRRRRSASSPRTKTTSRRGRSPSPKPRGLQRSRSRSRREKTRTTRRRDRSGSSQSTSRRRQRSRSRSRVTRRRRGGSGYHSRSPARQESSRTSSRRRRGRSRTPPTSRKRSRSRTSPAPWKRSRSRASPATHRRSRSRTPLISRRRSRSRTSPVSRRRSRSRTSVTRRRSRSRASPVSRRRSRSRTPPVTRRRSRSRTPTTRRRSRSRTPPVTRRRSRSRTPPVTRRRSRSRTSPITRRRSRSRTSPVTRRRSRSRTSPVTRRRSRSRTSPVTRRRSRSRTPPAIRRRSRSRTPLLPRKRSRSRSPLAIRRRSRSRTPRTARGKRSLTRSPPAIRRRSASGSSSDRSR
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Mol. Weight

53.8 kDa

Protein Length

Partial

Tag Info

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Tris-based buffer，50% glycerol

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function

Required for pre-mRNA splicing as component of the spliceosome.

Gene References into Functions

cellular complexes comprising cactin, DHX8 and SRRM2 sustain precise chromosome segregation, genome stability and cell proliferation by allowing faithful splicing of specific pre-mRNAs. PMID: 28062851
The S346F mutation in SRRM2 predisposes to papillary thyroid carcinoma by affecting alternative splicing of unidentified downstream target genes. PMID: 26135620
Data show that the consistent dysregulation of the RNA splicing factor SRRM2 in two different PD neuronal sources and in PD blood makes SRRM2 a strong candidate gene for PD and draws attention to the role of RNA splicing in the disease. PMID: 20161708
results suggest multiple functions for Cwc21/SRm300 in the splicing process, including an important role in the activation of splicing in association with Isy1. PMID: 19789211
demonstrate that SRm300, the only serine arginine-related protein known to be at the core of human catalytic spliceosomes, is a functional ortholog of Cwc21p, also interacting directly with Prp8p and Snu114p. PMID: 19854871

Hide All

Subcellular Location

Nucleus. Nucleus speckle.

Protein Families

CWC21 family

Tissue Specificity

Expressed in liver, placenta, and white blood cells.

Database Links

HGNC: 16639

OMIM: 606032

KEGG: hsa:23524

STRING: 9606.ENSP00000301740