Home
Protein
Recombinant Proteins
Recombinant Human Serine/threonine-protein kinase PAK 5 (PAK5), partial

Recombinant Human Serine/threonine-protein kinase PAK 5 (PAK5), partial

^{In Stock}

Code	CSB-BP885798HU
Abbreviation	Recombinant Human PAK5 protein, partial
MSDS	MSDS Datasheet
Size	$528
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

PAK5

Uniprot No.

Q8TB93

Research Area

Cancer

Source

Baculovirus

Expression Region

1-293aa

Target Protein Sequence

MFGKKKKKIEISGPSNFEHRVHTGFDAQEQKFTGLPQQWHSLLADTANRPKPMVDPSCITPIQLAPMKTIVRGNKPCKETSINGLLEDFDNISVTRSNSLRKESPPTPDQGASSHGPGHAEENGFITFSQYSSESDTTADYTTEKYREKSLYGDDLDPYYRGSHAAKQNGHVMKMKHGEAYYSEVKPLKSDFARFSADYHSHLDSLSKPSEYSDLKWEYQRASSSSPLDYSFQFTPSRTAGTSGCSKESLAYSESEWGPSLDDYDRRPKSSYLNQTSPQPTMRQRSRSGSGLQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

34.9kDa

Protein Length

Partial

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The expression region of this recombinant Human PAK5 covers amino acids 1-293. This PAK5 protein is theoretically predicted to have a molecular weight of 34.9 kDa. This PAK5 protein is produced using baculovirus expression system. The N-terminal 6xHis tag was fused into the coding gene segment of PAK5, making it easier to detect and purify the PAK5 recombinant protein in the later stages of expression and purification.

Serine/threonine-protein kinase PAK 5 (PAK5) is a widely studied protein with significant roles in cell signaling and cancer biology. PAK5 is primarily investigated in the fields of cell polarity, cell movement, and proliferation regulation. In these processes, PAK5 influences cell morphology and movement by orchestrating the reorganization of the cell's cytoskeleton and phosphorylation of substrate proteins. Additionally, PAK5 is closely linked to the occurrence and progression of various cancers, gradually becoming a key focus in cancer biology research.