Code | CSB-EP624036HU |
Abbreviation | Recombinant Human STK11 protein |
MSDS | |
Size | $224 |
Order now | |
Image |
|
Have Questions? | Leave a Message or Start an on-line Chat |
This Recombinant Human STK11 protein is an essential tool for your apoptosis research needs. Serine/threonine-protein kinase STK11, also known as LKB1 or PJS, is a key regulator of cell polarity and energy metabolism. Its involvement in apoptosis and other cellular processes, such as cell proliferation and differentiation, makes it a vital target for understanding the intricate mechanisms governing cell fate.
Our Recombinant Human STK11 protein is expressed in E.coli, ensuring robust production of the full length of mature protein (1-430aa). The N-terminal 6xHis-SUMO tag allows for efficient purification and detection while maintaining the protein's native structure and function. With a purity greater than 90% as determined by SDS-PAGE, our Recombinant Human STK11 protein ensures reliability and reproducibility in your experiments. Available in both liquid and lyophilized powder forms, our product offers the versatility to suit your specific research requirements.
There are currently no reviews for this product.
I have a customer question about CSB-EP624036HU. The customer asks for the purification method for this protein. Is the method denaturing or non-denaturing? Would you have this information available to share?
MEVVDPQQLGMFTEGELMSVGMDTFIHRIDSTEVIYQPRRKRAKLIGKYLMGDLLGEGSYGKVKEVLDSETLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHKNVIQLVDVLYNEEKQKMYMVMEYCVCGMQEMLDSVPEKRFPVCQAHGYFCQLIDGLEYLHSQGIVHKDIKPGNLLLTTGGTLKISDLGVAEALHPFAADDTCRTSQGSPAFQPPEIANGLDTFSGFKVDIWSAGVTLYNITTGLYPFEGDNIYKLFENIGKGSYAIPGDCGPPLSDLLKGMLEYEPAKRFSIRQIRQHSWFRKKHPPAEAPPIPPSPDTKDRWRSMTVVPYLEDLHGADEDEDLFDIEDDIIYTQDFTVPGQVPEEEASHNGQRRGLPKAVCMNGTEAAQLSTKSRAEGRAPNPARKACSASSKIRRLSAC