Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

ASH2L

Uniprot No.

Q9UBL3

Research Area

Transcription

Alternative Names

ASH 2; Ash2 (absent small or homeotic) like; Ash2 (absent; small; or homeotic) like (Drosophila); ASH2; ASH2 LIKE; ASH2 like protein; ASH2-like protein; Ash2l; ASH2L_HUMAN; ASH2L1 ; ASH2L2; Bre 2; Bre2; Discs 2-like; Drosophila absent; small; or homeotic; Drosophila ASH2-like; Set1/Ash2 histone methyltransferase complex subunit ASH2

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

1-534aa

Target Protein Sequence

MDTQAGSVDEENGRQLGEVELQCGICTKWFTADTFGIDTSSCLPFMTNYSFHCNVCHHSGNTYFLRKQANLKEMCLSALANLTWQSRTQDEHPKTMFSKDKDIIPFIDKYWECMTTRQRPGKMTWPNNIVKTMSKERDVFLVKEHPDPGSKDPEEDYPKFGLLDQDLSNIGPAYDNQKQSSAVSTSGNLNGGIAAGSSGKGRGAKRKQQDGGTTGTTKKARSDPLFSAQRLPPHGYPLEHPFNKDGYRYILAEPDPHAPDPEKLELDCWAGKPIPGDLYRACLYERVLLALHDRAPQLKISDDRLTVVGEKGYSMVRASHGVRKGAWYFEITVDEMPPDTAARLGWSQPLGNLQAPLGYDKFSYSWRSKKGTKFHQSIGKHYSSGYGQGDVLGFYINLPEDTETAKSLPDTYKDKALIKFKSYLYFEEKDFVDKAEKSLKQTPHSEIIFYKNGVNQGVAYKDIFEGVYFPAISLYKSCTVSINFGPCFKYPPKDLTYRPMSDMGWGAVVEHTLADVLYHVETEVDGRRSPPWEP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

76.2kDa

Protein Length

Full Length of Isoform 3

Tag Info

N-terminal 6xHis-SUMO-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The recombinant Human ASH2L protein expression in e.coli cells requires the insertion of a DNA fragment encoding the Human ASH2L protein (1-534aa) into a plasmid vector and the transferral of this vector into e.coli cells. The positive cells are screened, cultured, and then induced to express the ASH2L protein. The protein carries a N-terminal 6xHis-SUMO tag. The cells are lysed to harvest the recombinant Human ASH2L protein, which is purified through affinity purification and then detected by SDS-PAGE and subsequent staining of the gel with Coomassie Brilliant Blue. The purity of this recombinant Human ASH2L protein is over 90%.

Target Background

Function

Transcriptional regulator. Component or associated component of some histone methyltransferase complexes which regulates transcription through recruitment of those complexes to gene promoters. Component of the Set1/Ash2 histone methyltransferase (HMT) complex, a complex that specifically methylates 'Lys-4' of histone H3, but not if the neighboring 'Lys-9' residue is already methylated. As part of the MLL1/MLL complex it is involved in methylation and dimethylation at 'Lys-4' of histone H3. May play a role in hematopoiesis. In association with RBBP5 and WDR5, stimulates the histone methyltransferase activities of KMT2A, KMT2B, KMT2C, KMT2D, SETD1A and SETD1B.

Gene References into Functions

our results suggest that ASH2L contributes to leukemogenesis by cooperating with other proteins that aberrantly upregulate cellular growth and proliferation pathways. PMID: 28185526
different cancer mutations in MLL1 lead to a loss or increase in activity, illustrating the complex and tumor-specific role of MLL1 in carcinogenesis. PMID: 28182322
Overall, epigenetic modulation is a promising approach to evaluate the role of chromatin structure for the radioresponsiveness of glioma cell lines. PMID: 28044469
Data suggest an interplay between megakaryocytic leukemia 1 (MKL1) and ASH2 protein to promote tumor necrosis factor alpha (TNF-alpha) induced proinflammatory transcription in macrophages. PMID: 28218970
the histone methyltransferase core enzyme ASH2L was bound at EGFR in the germinal matrix and in gliomas where levels of H3K4me3 are high, and the histone acetyltransferase P300 was bound in samples with H3K27ac enrichment PMID: 25996283
Ash2L acts in concert with P53 promoter occupancy to activate RNA Polymerase II by aiding formation of a stable transcription pre-initiation complex required for its activation. PMID: 25023704
ASH2L enhances ERalpha expression as a coactivator of GATA3 in breast cancers PMID: 25258321
Non active site mutations in the MLL1 SET domain render the protein defective for H3K4 dimethylation by the MLL1 core complex, which is associated with a loss of the ability of MLL1 to interact with WRAD or with the RbBP5/Ash2L heterodimer. PMID: 24680668
H2B dependent regulation of MLL family histone methylatransferases depends on the N-terminal WH motif of ASH2L. PMID: 23453805
crystal structure of the C-terminal SPRY domain of human Ash2L PMID: 22231628
The structure shows that Ash2L contains an atypical PHD finger that does not have histone tail-binding activity. PMID: 21660059
ASH2L binds DNA using a forkhead-like helix-wing-helix (HWH) domain. PMID: 21642971
NF-Y acts upstream of H3K4me3 deposition by recruiting Ash2L PMID: 21445285
Protein-arginine methyltransferase 1 (PRMT1) methylates Ash2L, a shared component of mammalian histone H3K4 methyltransferase complexes. PMID: 21285357
Data suggest that both Ash2L/RbBP5 and the MLL1 SET domain make direct contacts with the substrates and contribute to the formation of a joint catalytic center. PMID: 21124902
Results show that Depletion of CHD8 enhances HOXA2 expression and a loss of the WDR5/Ash2L/RbBP5 subcomplex. PMID: 20085832
Ash2l and Saf-A are recruited to the inactive X chromosome at the onset of stable X inactivation. PMID: 20150277
high dimethylation of histone H3 at lysine 4 expression is rare in hepatocellular carcinoma compared with other carcinomas, possibly due to complex epigenetic regulation involving Ash2 PMID: 19896696
These findings offer insight into the molecular role of ASH2L, and by extension that of WDR5, in proper H3K4 trimethylation. PMID: 16892064
Although hASH2 expression at the mRNA level was not deregulated, hASH2 protein expression was increased in most human tumors and tumor cell lines. Knockdown of hASH2 inhibited tumor cell proliferation. These show hASH2 as a novel oncoprotein. PMID: 18245475
The identified components revealed factors involved in histone methylation and cell cycle control and include Ash2L, RbBP5, WDR5, HCF-1, DBC-1, and EMSY. PMID: 19131338

Hide All

Subcellular Location

Nucleus.

Tissue Specificity

Ubiquitously expressed. Predominantly expressed in adult heart and testis and fetal lung and liver, with barely detectable expression in adult lung, liver, kidney, prostate, and peripheral leukocytes.

Database Links

HGNC: 744

OMIM: 604782

KEGG: hsa:9070

STRING: 9606.ENSP00000340896

UniGene: Hs.521530

Code	CSB-EP883363HU
Abbreviation	Recombinant Human ASH2L protein
MSDS	MSDS Datasheet
Size	$224
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Set1/Ash2 histone methyltransferase complex subunit ASH2 (ASH2L)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage