Recombinant Human Slit homolog 3 protein (SLIT3), partial

In Stock
Code CSB-EP021769HU
Abbreviation Recombinant Human SLIT3 protein, partial
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Cell Biology
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
34-155aa
Target Protein Sequence
CPTKCTCSAASVDCHGLGLRAVPRGIPRNAERLDLDRNNITRITKMDFAGLKNLRVLHLEDNQVSVIERGAFQDLKQLERLRLNKNKLQVLPELLFQSTPKLTRLDLSENQIQGIPRKAFRG
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
17.9 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
May act as molecular guidance cue in cellular migration, and function may be mediated by interaction with roundabout homolog receptors.
Gene References into Functions
  1. Overexpression of Slit3 induces its tumor suppressive effects in Breast cancer. PMID: 26542734
  2. Results show that silencing of Slit3 promoted proliferation, migration and invasion of A549 cells and induced epithelial-mesenchymal transition suggesting that Slit3 functions as a tumor suppressor in lung carcinoma. PMID: 26045181
  3. Estrogen-dependent expression of SLIT3 may play a key role in regulating nerve-vessel interactions within the complex microenvironment of endometriosis lesions. PMID: 25051436
  4. SLIT3 is increased with labour, and both amnion and myometrial studies describe a pro-inflammatory effect of SLIT3 in these tissues. PMID: 24286238
  5. High SLIT3 expression is associated with high-grade gliomas. PMID: 24158112
  6. SLIT3-ROBO4 activation promotes vascular network formation in human engineered tissue and angiogenesis in vivo. PMID: 24090675
  7. results implicate the involvement of miR-218-2 and its host gene SLIT3 in thyroid cancer cell invasion, migration, and proliferation PMID: 23720784
  8. Slit3 treatment increased the in vivo homing efficiency of CD34 HSPCs to the BM in NOD/SCID mice, whereas Slit3-exposed HSPC migration in vitro was inhibited. Results support a role for Slit3 in human HSPC migration in vitro and homing in vivo. PMID: 22614124
  9. SLIT3 duplication on 5q35.1 predisposes to major depressive disorder PMID: 21152026
  10. The chemorepellent Slit3 promotes monocyte migration. PMID: 21078908
  11. Slit3 inhibits Robo3-induced invasion of synovial fibroblasts in rheumatoid arthritis. PMID: 20298552
  12. Many variants in SLIT3 tend to associate with schizophrenia susceptibility in the Chinese Han population. PMID: 15231749
  13. data suggest that Slit proteins play a key role in guiding dorsally projecting cranial motoneurons and in facilitating their neural tube exit PMID: 16162649
  14. In fetal and embryonic stem cell cultures Slit-3 inhibited neurite outgrowth. PMID: 16840550
  15. functions to promote angiogenesis in coordinating organogenesis during embryonic development PMID: 19741192

Show More

Hide All

Subcellular Location
Secreted.
Tissue Specificity
Predominantly expressed in thyroid.
Database Links

HGNC: 11087

OMIM: 603745

KEGG: hsa:6586

STRING: 9606.ENSP00000430333

UniGene: Hs.552087

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*