Recombinant Human Small proline-rich protein 3 (SPRR3)

In Stock
Code CSB-EP022619HU
Abbreviation Recombinant Human SPRR3 protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
SPRR3
Uniprot No.
Research Area
Neuroscience
Alternative Names
22 kDa pancornulin; Cornifin beta; Esophagin; Small proline rich protein 3; Small proline-rich protein 3; SPRC; Sprr3; SPRR3_HUMAN
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
2-169aa
Target Protein Sequence
SSYQQKQTFTPPPQLQQQQVKQPSQPPPQEIFVPTTKEPCHSKVPQPGNTKIPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGYTKVPEPGSIKVPDQGFIKFPEPGAIKVPEQGYTKVPVPGYTKLPEPCPSTVTPGPAQQKTKQK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
34.0kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The generation of the recombinant Human SPRR3 protein typically includes the following steps: synthesizing the recombinant plasmid containing the gene encoding the Human SPRR3 protein (2-169aa), transforming the recombinant plasmid into e.coli cells, selecting the positive e.coli cells, and culturing the positive e.coli cells for protein expression. The protein is equipped with a N-terminal 6xHis-SUMO tag. After expression, affinity purification is employed to isolate and purify the recombinant SPRR3 protein from the cell lysate. Denaturing SDS-PAGE is utilized to resolve the resulting recombinant Human SPRR3 protein, revealing a purity level exceeding 90%.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Cross-linked envelope protein of keratinocytes.
Gene References into Functions
  1. SPRR3v2 mRNA level in non-lesional AD skin correlated with severity of AD, and SPRR3 protein level in non-lesional AD skin correlated inversely with pruritus. PMID: 27304082
  2. Results implicate that SPRR3 might serve as a radiation-sensitive predictor of ESCC. PMID: 23820115
  3. This study demonstrates that SPRR3 promotes BC cell proliferation by enhancing p53 degradation via the AKT and MAPK pathways PMID: 22076481
  4. The quantitative analysis of SPRR3 mRNA is a robust and reliable method to monitor the malignant transformation of the healthy esophageal mucosa into esophageal squamous cell carcinoma. PMID: 21777580
  5. The SPRR3 variant associated with eczema carried an extra 24-bp repeat in the central domain, which may alter the physical properties of the cornified cell envelope PMID: 21490620
  6. Results suggest that increased expression of SPRR3 is involved in colorectal tumorigenesis. PMID: 20379613
  7. two isoforms of SPRR3 were characterized from saliva of preterm human newborn and autoptic fetal oral mucosa, parotid and submandibular gland samples. PMID: 20599699
  8. Sciellin, SPRR3, and periplakin transcripts were all upregulated (4.67-, 4.95-, 2.77-fold, respectively) by prolonged exposure to cyclic strain (24-72 h), but not at earlier time points. PMID: 19211270
  9. SPR3 transcripts were significantly increased in human papillomavirus 11-infected tissues and minimally increased in human papillomavirus 59-infected tissues PMID: 14748073
  10. A marker of human esophageal neoplastic progression PMID: 15221970
  11. Esophagin/SPRR3 may play a role in the maintenance of normal esophageal epithelial homeostasis, and aberrant expression of Esophagin/SPRR3 may contribute to the tumorigenesis of esophageal squamous cell carcinoma PMID: 17935133
  12. These data suggest that SPRR3 may play a role in vascular smooth muscle cells adaptation to local biomechanical stress within the plaque microenvironment. PMID: 18832573

Show More

Hide All

Subcellular Location
Cytoplasm.
Protein Families
Cornifin (SPRR) family
Database Links

HGNC: 11268

OMIM: 182271

KEGG: hsa:6707

STRING: 9606.ENSP00000295367

UniGene: Hs.139322

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*