Home
Protein
Recombinant Proteins
Recombinant Human Small proline-rich protein 3 (SPRR3)

Recombinant Human Small proline-rich protein 3 (SPRR3)

^{In Stock}

Code	CSB-EP022619HU
Abbreviation	Recombinant Human SPRR3 protein
MSDS	MSDS Datasheet
Size	$224
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

SPRR3

Uniprot No.

Q9UBC9

Research Area

Neuroscience

Alternative Names

22 kDa pancornulin; Cornifin beta; Esophagin; Small proline rich protein 3; Small proline-rich protein 3; SPRC; Sprr3; SPRR3_HUMAN

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

2-169aa

Target Protein Sequence

SSYQQKQTFTPPPQLQQQQVKQPSQPPPQEIFVPTTKEPCHSKVPQPGNTKIPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGYTKVPEPGSIKVPDQGFIKFPEPGAIKVPEQGYTKVPVPGYTKLPEPCPSTVTPGPAQQKTKQK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

34.0kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-SUMO-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The generation of the recombinant Human SPRR3 protein typically includes the following steps: synthesizing the recombinant plasmid containing the gene encoding the Human SPRR3 protein (2-169aa), transforming the recombinant plasmid into e.coli cells, selecting the positive e.coli cells, and culturing the positive e.coli cells for protein expression. The protein is equipped with a N-terminal 6xHis-SUMO tag. After expression, affinity purification is employed to isolate and purify the recombinant SPRR3 protein from the cell lysate. Denaturing SDS-PAGE is utilized to resolve the resulting recombinant Human SPRR3 protein, revealing a purity level exceeding 90%.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function

Cross-linked envelope protein of keratinocytes.

Gene References into Functions

SPRR3v2 mRNA level in non-lesional AD skin correlated with severity of AD, and SPRR3 protein level in non-lesional AD skin correlated inversely with pruritus. PMID: 27304082
Results implicate that SPRR3 might serve as a radiation-sensitive predictor of ESCC. PMID: 23820115
This study demonstrates that SPRR3 promotes BC cell proliferation by enhancing p53 degradation via the AKT and MAPK pathways PMID: 22076481
The quantitative analysis of SPRR3 mRNA is a robust and reliable method to monitor the malignant transformation of the healthy esophageal mucosa into esophageal squamous cell carcinoma. PMID: 21777580
The SPRR3 variant associated with eczema carried an extra 24-bp repeat in the central domain, which may alter the physical properties of the cornified cell envelope PMID: 21490620
Results suggest that increased expression of SPRR3 is involved in colorectal tumorigenesis. PMID: 20379613
two isoforms of SPRR3 were characterized from saliva of preterm human newborn and autoptic fetal oral mucosa, parotid and submandibular gland samples. PMID: 20599699
Sciellin, SPRR3, and periplakin transcripts were all upregulated (4.67-, 4.95-, 2.77-fold, respectively) by prolonged exposure to cyclic strain (24-72 h), but not at earlier time points. PMID: 19211270
SPR3 transcripts were significantly increased in human papillomavirus 11-infected tissues and minimally increased in human papillomavirus 59-infected tissues PMID: 14748073
A marker of human esophageal neoplastic progression PMID: 15221970
Esophagin/SPRR3 may play a role in the maintenance of normal esophageal epithelial homeostasis, and aberrant expression of Esophagin/SPRR3 may contribute to the tumorigenesis of esophageal squamous cell carcinoma PMID: 17935133
These data suggest that SPRR3 may play a role in vascular smooth muscle cells adaptation to local biomechanical stress within the plaque microenvironment. PMID: 18832573