Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Neuroscience
Alternative Names
22 kDa pancornulin; Cornifin beta; Esophagin; Small proline rich protein 3; Small proline-rich protein 3; SPRC; Sprr3; SPRR3_HUMAN
Species
Homo sapiens (Human)
Expression Region
2-169aa
Target Protein Sequence
SSYQQKQTFTPPPQLQQQQVKQPSQPPPQEIFVPTTKEPCHSKVPQPGNTKIPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGYTKVPEPGSIKVPDQGFIKFPEPGAIKVPEQGYTKVPVPGYTKLPEPCPSTVTPGPAQQKTKQK
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The generation of the recombinant Human SPRR3 protein typically includes the following steps: synthesizing the recombinant plasmid containing the gene encoding the Human SPRR3 protein (2-169aa), transforming the recombinant plasmid into e.coli cells, selecting the positive e.coli cells, and culturing the positive e.coli cells for protein expression. The protein is equipped with a N-terminal 6xHis-SUMO tag. After expression, affinity purification is employed to isolate and purify the recombinant SPRR3 protein from the cell lysate. Denaturing SDS-PAGE is utilized to resolve the resulting recombinant Human SPRR3 protein, revealing a purity level exceeding 90%.
