Code | CSB-YP020834HU |
MSDS | |
Size | Pls inquire |
Source | Yeast |
Have Questions? | Leave a Message or Start an on-line Chat |
Code | CSB-EP020834HU-B |
MSDS | |
Size | Pls inquire |
Source | E.coli |
Conjugate | Avi-tag Biotinylated E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag. |
Have Questions? | Leave a Message or Start an on-line Chat |
There are currently no reviews for this product.
1. Please can you provide sequence, pricing, availability and tag information for this protein?
2. We would like to know the tag information and is especially interested in the E. coli and mammalian expressed protein. Also we would like to receive the protein in lyophilized format (preferably in multiple aliquots depending on size we order), is this protein suitable to be supplied in lyophilized format?
3. Have you received any customer feedback about the activity of this protein?
MEQTVLVPPGPDSFNFFTRESLAAIERRIAEEKAKNPKPDKKDDDENGPKPNSDLEAGKNLPFIYGDIPPEMVSEPLEDLDPYYINKKTFIVLNKGKAIFRFSATSALYILTPFNPLRKIAIKILVHS