Recombinant Human Sodium channel protein type 1 subunit alpha (SCN1A),partial

Code CSB-MP020834HU
Abbreviation Recombinant Human SCN1A protein, partial
MSDS
Size $290
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Neuroscience
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
1-128aa
Target Protein Sequence
MEQTVLVPPGPDSFNFFTRESLAAIERRIAEEKAKNPKPDKKDDDENGPKPNSDLEAGKNLPFIYGDIPPEMVSEPLEDLDPYYINKKTFIVLNKGKAIFRFSATSALYILTPFNPLRKIAIKILVHS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
43.4 kDa
Protein Length
Partial
Tag Info
C-terminal hFc1-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Mediates the voltage-dependent sodium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a sodium-selective channel through which Na(+) ions may pass in accordance with their electrochemical gradient. Plays a key role in brain, probably by regulating the moment when neurotransmitters are released in neurons. Involved in sensory perception of mechanical pain: activation in somatosensory neurons induces pain without neurogenic inflammation and produces hypersensitivity to mechanical, but not thermal stimuli.
Gene References into Functions
  1. Our cases represent a novel association between SCN1A and sudden infant death syndrome (SIDS), extending the SCN1A spectrum from epilepsy to SIDS. PMID: 29601086
  2. The effect of Ca(2+), domain-specificity, and CaMKII on CaM binding to NaV1.1 has been reported. PMID: 30142967
  3. This first genetic study of Dravet syndrome in Africa confirms that de novo SCN1A variants underlie disease in the majority of South African patients. PMID: 30321769
  4. these data suggest that MDH2, functioning as an RNA-binding protein, is involved in the posttranscriptional downregulation of SCN1A expression under seizure condition. PMID: 28433711
  5. Postzygotic mutation is a common phenomenon in SCN1A-related epilepsies. Participants with mosaicism have on average milder phenotypes, suggesting that mosaicism can be a major modifier of SCN1A-related diseases. PMID: 29460957
  6. SCN1A and SCN2A mutations and clinical/EEG features in Chinese patients from epilepsy or severe seizures PMID: 29649454
  7. rs7668282 (UGT2B7, T>C) was more prevalent in sodium valproate (VPA)-resistant patients than drug-responsive patients. rs2242480 (CYP3A4, C>T) and rs10188577 (SCN1A, T>C) were more prevalent in drug-responsive patients compared to drug-resistant patients. In children with generalized seizures on VPA therapy, polymorphisms of UGT2B7, CYP3A4, and SCN1A genes were associated with seizure reduction. PMID: 29679912
  8. Meta-analysis indicates that the A-allele of SCN1A rs2298771 polymorphism, especially AA genotype, may play an important role in responsiveness to sodium channel blocking antiepileptic drugs, while SCN1A rs3812718 polymorphism is not associated. PMID: 29582177
  9. Study established induced pluripotent stem cells (iPSC)from two Dravet syndrome patients with different mutations in SCN1A and subsequently differentiated them into forebrain GABAergic neurons. Unique genetic alterations of SCN1A differentially impacted electrophysiological impairment of the neurons, and the impairment's extent corresponded with the symptomatic severity of the donor from which the iPSCs were derived. PMID: 29295803
  10. miR155 may be associated with the risk of seizure and SCN1A may be a target gene of miR155. PMID: 29115566
  11. we report a Chinese familial hemiplegic migraine type 3 family with a novel mutation in the SCN1A gene. PMID: 27919014
  12. The polymorphic SCN1A c.3184A>G/p.Thr1067Ala G allele was associated with a lower risk of epilepsy and a higher remission rate in Slovenian children and adolescents with epilepsy. PMID: 28753467
  13. The evaluation of an SCN1A mutation. PMID: 27582020
  14. These findings provide insight into a pharmacophore on domain IV voltage sensor through which modulation of inactivation gating can inhibit or facilitate Nav1.1 function. PMID: 28607094
  15. SCN1A rs3812718 polymorphism is a risk factor for GEFS+, and the population carrying T allele may have an increased risk of GEFS. PMID: 29429462
  16. study showed a significant association between rs6730344, rs6732655 and rs10167228 polymorphisms in the intronic regions of the SCN1A gene and refractory epilepsy, thus emerging as risk factors for drug resistance PMID: 29353705
  17. showed large-scale developmental brain changes in patients with epilepsy and SCN1A gene mutation, which may be associated with the core symptoms of the patients PMID: 28664031
  18. These data provide evidence that Nav1.1 is indeed vulnerable to deltamethrin modification at lower concentrations than Nav1.6, and this effect is primarily mediated during the resting state. PMID: 28007400
  19. SCN1A deletions are more common than SCN1A duplications among Dravet syndrome patients, and the most common types are whole SCN1A deletions. PMID: 29188601
  20. Two novel missense mutations: p.G325A in the KDM6A gene responsible for Kabuki syndrome and p.G1877V in the SCN1A gene responsible for generalized epilepsy with febrile seizures plus were identified using the TruSight One sequencing panel. PMID: 28442529
  21. Similar to the known FHM3 mutations, this novel mutation predicts hyperexcitability of GABAergic inhibitory neurons. PMID: 26763045
  22. Study found in patients with focal seizures a seemingly uneven distribution of mutations within the SCN1A gene. Study identified valproic acid, stiripentol, and clobazam to be 3 medications that have the best effect on management of focal seizures due to an SCN1A mutation similar to what is seen in most cases of Dravet Syndrome. PMID: 27777328
  23. A novel SCN1A mutation was found in an 8-year-old boy with GEFS+. The father has the same mutation, but he only had childhood simple febrile seizures. PMID: 28262406
  24. In this study, we performed exome sequencing in six patients with SCN1A-negative Dravet syndrome to identify other genes related to this disorder..the data in this study identify GABRB3 as a candidate gene for Dravet syndrome PMID: 28544625
  25. Dravet syndrome-derived inhibitory neurons showed deficits in sodium currents and action potential firing, which were rescued by a Nav1.1 transgene, whereas Dravet excitatory neurons were normal. PMID: 27458797
  26. The results further substantiate the contribution of SCN1A in response and therapy optimization with PHT monotherapy. PMID: 27245092
  27. Rather than a single common gene/variant modifying clinical outcome in SCN1A-related epilepsies, our results point to the cumulative effect of rare variants with little to no measurable phenotypic effect (i.e., typical genetic background) unless present in combination with a disease-causing truncation mutation in SCN1A. PMID: 28686619
  28. The frequency of pathogenic variants was 4.17% in the patients with refractory epilepsy and Dravet syndrome and 11.1% in DS patients. L1775P missense mutation was predicted to be damaging with a score of 100% by the PolyPhen-2 program. PMID: 28525652
  29. genetic variants in 3'UTR of SCN1A PMID: 27473590
  30. Among these transmissions were two likely disease-causing mutations: an SCN1A mutation transmitted to an SUDC proband and her sibling with Dravet syndrome, as well as an SLC6A1 mutation in a proband with epileptic encephalopathy. PMID: 26716362
  31. study presents a phenotype-genotype correlation for SCN1A; described a distinct SCN1A phenotype, early infantile SCN1A encephalopathy, which is readily distinguishable from the Dravet syndrome and genetic epilepsy with febrile seizures plus PMID: 28794249
  32. This study demonstrated that early-life prolonged FSs have a profound long-term impact on neuronal function and adult seizure phenotypes in a mouse model of human SCN1A dysfunction. PMID: 28373025
  33. Pathogenic, likely pathogenic, and benign variants in SCNs were identified using databases of sodium channel variants. Benign variants were also identified from population-based databases. Eight algorithms commonly used to predict pathogenicity were compared. In addition, logistic regression was used to determine if a combination of algorithms could better predict pathogenicity. PMID: 28518218
  34. this study showed that SCN1A testing be considered in all individuals with febrile seizures or Dravet syndrome , as well as in familial cases consistent with febrile seizures. PMID: 28084635
  35. This study found significant differences in the distribution of truncating and missense variants across the SCN1A sequence among healthy individuals, patients with Dravet syndrome. PMID: 28012175
  36. A heterozygous mutation h1u-1962 T > G was identified in a patient with partial epilepsy and febrile seizures, which was aggravated by oxcarbazepine. PMID: 26969601
  37. SCN1A mutations may alter axonal function, causing motor neuropathy/neuronopathy. This may contribute to gait disturbance and orthopedic misalignment, which is characteristic of patients with Dravet syndrome. PMID: 27316242
  38. The association study indicated that age at first seizure and frameshift mutations of SCN1A were associated with Dravet syndrome. PMID: 28202706
  39. Study reported the range of rare copy number variants found in SCN1A gene in a series of Welsh patients with childhood-onset epilepsy and intellectual disability and identified clearly or likely pathogenic CNVs in 8.8 % of the patients including 5 rare de novo deletions. PMID: 27113213
  40. Our findings suggest that SCN1A mutation leads to changes in the dopamine system that may contribute to the behavioral abnormalities in DS. PMID: 26841829
  41. This study demonstrated that a significant higher frequency of the AG genotype (p=0.001) and G allele (p=0.006) of SCN1A polymorphism in epileptic patients than in controls. PMID: 27498208
  42. Dravet syndrome is associated with mutations in the sodium channel alpha1 subunit gene (SCN1A) in 70-80% of individuals. PMID: 27264139
  43. The presence of SCN1A mutations and absence of mutations in ATP1A2 or CACNA1A suggest that the Polish patients represent FHM type 3. PMID: 26747084
  44. The findings of this study in scn1a mutant zebrafish suggest that glucose and mitochondrial hypometabolism contribute to the pathophysiology of DS. PMID: 27066534
  45. Mutations in SCN1A, the gene that encodes the alpha subunit of voltage-gated sodium channel Nav1.1, can cause epilepsies. PMID: 26731440
  46. Retrospective study to survey the efficacy of antiepileptic drugs in Dravet syndrome with different SCN1A genotypes PMID: 26183863
  47. No causative variants were identified in any of non-DS epileptic patients in our cohort, suggesting a minor, but not irrelevant role for SCN1A in patients with other types of childhood epilepsy. PMID: 27045673
  48. Mutations in SCN1A and SCN2A are a predisposing factor of acute encephalopathy with biphasic seizures and late reduced diffusion PMID: 26311622
  49. Evaluation of Presumably Disease Causing SCN1A Variants in a Cohort of Common Epilepsy Syndromes. PMID: 26990884
  50. The SCN1A IVS5-91G>A SNP is associated with susceptibility to epilepsy. SNPs in EPHX1 gene are influencing CBZ metabolism and disposition PMID: 26555147

Show More

Hide All

Involvement in disease
Generalized epilepsy with febrile seizures plus 2 (GEFS+2); Epileptic encephalopathy, early infantile, 6 (EIEE6); Intractable childhood epilepsy with generalized tonic-clonic seizures (ICEGTC); Migraine, familial hemiplegic, 3 (FHM3); Febrile seizures, familial, 3A (FEB3A)
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
Sodium channel (TC 1.A.1.10) family, Nav1.1/SCN1A subfamily
Database Links

HGNC: 10585

OMIM: 182389

KEGG: hsa:6323

STRING: 9606.ENSP00000303540

UniGene: Hs.22654

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*