Recombinant Human Sodium/iodide cotransporter (SLC5A5), partial

In Stock
Code CSB-EP835713HU
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
SLC5A5
Uniprot No.
Research Area
Others
Alternative Names
(Na(+)(-)(Natrium iodide transporter)(Sodium-iodide symporter)(Na(+)(-)(Solute carrier family 5 member 5)
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
547-643aa
Target Protein Sequence
SCLTGPTKRSTLAPGLLWWDLARQTASVAPKEEVAILDDNLVKGPEELPTGNKKPPGFLPTNEDRLFFLGQKELEGAGSWTPCVGHDGGRDQQETNL
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
17.4 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The expression region of this recombinant Human SLC5A5 covers amino acids 547-643. The calculated molecular weight for this SLC5A5 protein is 17.4 kDa. This SLC5A5 protein is produced using e.coli expression system. The SLC5A5 coding gene included the C-terminal 6xHis tag, which simplifies the detection and purification processes of the recombinant SLC5A5 protein in following stages of expression and purification.

The human sodium/iodide cotransporter (SLC5A5) is a crucial membrane protein involved in the active transport of iodide ions across the cell membrane. Mainly expressed in thyroid follicular cells, SLC5A5 plays a pivotal role in thyroid hormone synthesis. It facilitates the uptake of iodide from the bloodstream into thyroid cells, an essential step for the production of thyroid hormones, thyroxine (T4), and triiodothyronine (T3). This process is integral to the regulation of metabolism and overall physiological homeostasis. Additionally, due to its ability to concentrate iodide, SLC5A5 has been utilized in medical imaging and radioiodine therapy for thyroid disorders, including thyroid cancer.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Mediates iodide uptake in the thyroid gland.
Gene References into Functions
  1. The present work reveals much lower iodide affinity in the pocket of human SMCT1 analogous to the putative iodide-binding pocket of human NIS. PMID: 29131623
  2. The expression of NIS differs insignificantly in gastric tissue of obese and control individuals. PMID: 29631680
  3. NIS localization in the follicular lumen in nodular goiter patients PMID: 28190186
  4. Results show transgene induction under hypoxia in tumor cell spheroid models, or radioiodide uptake using sodium iodide symporter (NIS). PMID: 27458162
  5. Data suggest iodination of TG is involved in regulation of NIS expression in thyroid follicle via TSH/TSHR signaling; NIS expression and PKA activity are up-regulated by lowly iodinated TG; NIS expression is down-regulated and PKC activity up-regulated by highly iodinated TG. (TG, thyroglobulin; NIS, sodium/iodide symporter; PK, protein kinase; TSH, thyroid-stimulating hormone; TSHR, thyroid-stimulating hormone receptor) PMID: 28396984
  6. Data indicate that although fewer than 25% of cells expressed Na+/I- symporter (NIS), combining131I- with gemcitabine (GEMGEM/131I)- caused dramatic tumor regression in NIS-transduced breast cancer brain metastases (BCBMs). PMID: 27363025
  7. Experiments in whole cells demonstrated that these four residues participate in transport by NIS: mutations at these positions result in proteins that, although expressed at the plasma membrane, transport little or no I(-) These residues are conserved throughout the entire SLC5 family, to which NIS belongs, suggesting that they serve a similar function in the other transporters PMID: 27562170
  8. Study brings out molecular evidence showing that NIS is a direct target of wild-type p53 and its activation upon Doxorubicin drug exposure results in suppression of NIS expression and function in breast cancer cells. PMID: 28528452
  9. radiotracer accumulation in transfected cells correlated with the induction of hNIS and with the expression of miRNAs detected by real time PCR. PMID: 28493972
  10. Results indicate that Na+/I- symporter (NIS) can be used as an objective used as an objective criterion for determining the sensitivity of luminal B and basal breast cancer (BC)subtypes to neoadjuvant chemotherapy (NACT). PMID: 28361851
  11. Our findings indicated that hTERT promoter-driven expression of the NIS gene in HeLa cells led to 188Re uptake and therapeutic effects. Thus, NIS-based gene therapy and imaging using the hTERT promoter and 188Re may be possible. PMID: 27573304
  12. SLC5A5 was down-regulated in FTC and PTC. Its expression could be modulated by hsa-let-7f-5p. ATC showed a loss of SLC5A5/hsa-let7f-5p correlation PMID: 26960757
  13. Mutating the sites located on the C-terminal domain of the protein has no effect except for the creation of a diacidic motif that decreases the total NIS protein level without affecting its expression at the plasma membrane. PMID: 26831514
  14. Therefore, enhancing functional NIS by the increasing level of glycosylation may be suggested as a promising therapeutic strategy for cancer patients who show refractory response to conventional radioiodine treatment. PMID: 26599396
  15. Our results confirmed that NIS overexpression enhances the sensitivity of ER-negative breast cancer cells to radioiodide therapy. PMID: 25955347
  16. miR-146b-3p binds to the 3'-untranslated region of PAX8 and sodium/iodide symporter, leading to impaired protein translation and a subsequent reduction in iodide uptake. PMID: 26282166
  17. Study demonstrates an association of one variant and several haplotypes of the NIS gene with differentiated thyroid cancer. PMID: 26160439
  18. Data suggest that SLC5A5, SLC5A8 (sodium-coupled monocarboxylate transporter 1), and SLC26A4 (pendrin), the 3 known iodide transporters, are important in breast tissue metabolism in lactation and in breast neoplasms. [REVIEW] PMID: 26285906
  19. Real time PCR revealed that both cell lines express mRNA of lactoferrin receptors while flow cytometry and confocal microscopy showed the cells efficiently internalize bLf which upregulates NIS expression. PMID: 26213306
  20. Although the affinity of NIS for I- is low, it increases when Na+ is bound. NIS takes advantage of the extracellular Na+ concentration and the pronounced increase in its own affinity for I- and for the second Na+ elicited by binding of the first. PMID: 24888603
  21. concluded that NIS-mediated RAIU could be modulated by miR-146b; accordingly, miR-146b might serve as one of targets to enhance efficacy of radioactive therapy against poorly differential thyroid carcinoma PMID: 25960292
  22. In normal salivary gland, striated duct cells strongly expressed NIS. In Warthin's tumors, eosinophilic epithelial cells exhibited NIS expression, but expression was varied among cases. Tc-positive specimens were NIS+. Tc-negative specimens were NIS-. PMID: 25199743
  23. Due to their low NIS expression, TCV and DSPTC need higher cumulative doses of radioactive iodine therapy to improve their prognosis. PMID: 24096868
  24. results indicate that the NIS mutation rate is very low in the Guangxi Zhuang Region, China, and it is necessary to study mutations of other genes that have major effects on thyroid dyshormonogenesis and have not as yet been studied in this population. PMID: 25465605
  25. Relatively weak melanoma-specific promoter directs high NIS activity in melanoma cell, however weaker cancer-specific promoters drive high NIS activity only in certain melanoma cell line. PMID: 25842835
  26. BRAF V600E inhibited NIS expression by the upregulation of its promoter methylation. Specific regions of CpG islands of NIS promoter in BRAF V600E harboring papillary thyroid carcinoma were highly methylated compared with surrounding normal tissue. PMID: 25378232
  27. Given the recent progress in the study of NIS regulation as molecular basis for new therapeutic approaches in extrathyroidal cancers. PMID: 24884806
  28. The expression of TSHR and NIS genes is differently controlled by multiple mechanisms, including epigenetic events elicited by major signaling pathways involved in thyroid tumorigenesis. PMID: 24353283
  29. NIS is a new ovarian cancer marker, opening a door for the use of radioiodide in the diagnosis and treatment of ovarian cancer patients. PMID: 24708099
  30. this study identified a new distal enhancer, NIS distal enhancer, that regulates gene expression through DNA methylation in thyroid cancer. PMID: 24432988
  31. The results suggest a a key structural role for the delta-amino group of R124 in the Na+/I- symporter's maturation and cell surface targeting. PMID: 23690546
  32. NIS expression is tightly modulated during the transition of intercalated to striated ducts and striated to excretory ducts in salivary ductal cells. NIS expression in salivary glands is decreased during inflammation and tumor formation PMID: 23441638
  33. Data indicate that Na+/I- symporter and type 3 iodothyronine deiodinase genes are expressed in term placenta and amniotic membrane. PMID: 23857380
  34. the NIS gene is a direct target of the p53 family. PMID: 24052075
  35. SLC5A5 is composed of 13 transmembrane helices and 643 amino acid residues in humans. (Review) PMID: 23988430
  36. Data indicate that interhelical interaction is required for Na(+)/I(-) symporter (NIS) folding and activity. PMID: 23650190
  37. Data from mutant recombinant proteins suggest that proto-oncogene PBF/PTTG1IP (pituitary tumor-transforming 1 interacting protein) is phosphoprotein and highlight importance of tyrosine residue Y174 in its interaction/co-localization with NIS. PMID: 23678037
  38. MEK inhibition leads to lysosome-mediated NIS protein degradation in human breast cancer cells PMID: 23404856
  39. The study indicates a positive link between hNIS and ER expression in breast cancer. PMID: 23342072
  40. NIS is highly expressed in early human trophoblast at the feto-maternal interface. PMID: 23174149
  41. Data indicate that MV-NIS, an oncolytic measles virus that encodes the human thyroidal sodium iodide symporter (NIS), deliver targeted radiotherapy to the tumor site and promote a localized bystander effect. above and beyond that achieved by MV alone. PMID: 23134812
  42. Data from various thyroid cancer cell lines suggest that PARP (poly(ADP-ribose) polymerase) inhibition increases NIS gene expression through a particular modulation of transcriptional regulatory mechanisms (i.e., specific histone modifications). PMID: 22982218
  43. Data indicate that expression of SLC5A5 in placenta is up-regulated during placentation; during the first trimester, SLC5A5 mRNA is low at 6 weeks and peaks at 12 weeks; expression of SLC5A5 protein increases with increased placental vascularization. PMID: 22954554
  44. Nevirapine may induce the up-regulation of NIS mRNA and TSHR mRNA in FRO anaplastic thyroid carcinoma cells. PMID: 22781452
  45. Molecular imaging of luciferase signal and sodium-iodide symporter imaging may be useful for in vivo optimization of bioenergetics in transplanted cells. PMID: 23255420
  46. Sodium/iodide symporter is expressed in the majority of seminomas and embryonal testicular carcinomas. PMID: 23117572
  47. our results established NIS as a carrier protein that interacts with a major cell signaling hub to facilitate tumor cell locomotion and invasion. PMID: 22962269
  48. The BRAF(V600E) mutation was associated with a statistically significant lower functional NIS protein expression in the classic variant of papillary thyroid carcinomas. PMID: 23163107
  49. CREM expression is increased in thyroid cancer tissue and may play a role in the downregulation of sodium iodide symporter expression in thyroid cancer acting at the transcriptional level PMID: 22510021
  50. analysis of subcellular distribution of the sodium iodide symporter in benign and malignant thyroid tissues PMID: 22545753

Show More

Hide All

Involvement in disease
Thyroid dyshormonogenesis 1 (TDH1)
Subcellular Location
Membrane; Multi-pass membrane protein.
Protein Families
Sodium:solute symporter (SSF) (TC 2.A.21) family
Tissue Specificity
Expression is primarily in thyroid tissue, but also to a lower extent in mammary gland and ovary. Expression is reduced in tumors.
Database Links

HGNC: 11040

OMIM: 274400

KEGG: hsa:6528

STRING: 9606.ENSP00000222248

UniGene: Hs.584804

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*