Recombinant Human Somatostatin (SST)

Code CSB-MP022723HU(A4)
Abbreviation Recombinant Human SST protein
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 95% as determined by SDS-PAGE.
Activity
Not Test
Target Names
SST
Uniprot No.
Research Area
Neuroscience
Alternative Names
Growth hormone release-inhibiting factor
Species
Homo sapiens (Human)
Source
Homo sapiens (Human)
Expression Region
25-116aa
Target Protein Sequence
APSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEPNQTENDALEPEDLSQAAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
39.3 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal hFc1-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Inhibits the secretion of pituitary hormones, including that of growth hormone/somatotropin (GH1), PRL, ACTH, luteinizing hormone (LH) and TSH. Also impairs ghrelin- and GnRH-stimulated secretion of GH1 and LH; the inhibition of ghrelin-stimulated secretion of GH1 can be further increased by neuronostatin.; May enhance low-glucose-induced glucagon release by pancreatic alpha cells. This effect may be mediated by binding to GPR107 and PKA activation. May regulate cardiac contractile function. May compromise cardiomyocyte viability. In the central nervous system, may impair memory retention and may affect hippocampal excitability. May also have anxiolytic and anorexigenic effects. May play a role in arterial pressure regulation. May inhibit basal, but not ghrelin- or GnRH-stimulated secretion of GH1 or LH, but does not affect the release of other pituitary hormones, including PRL, ACTH, FSH or TSH. Potentiates inhibitory action of somatostatin on ghrelin-stimulated secretion of GH1, but not that on GnRH-stimulated secretion of LH.
Gene References into Functions
  1. Temporal changes in levels of circulating SST mirror the temporal changes in the incidence of migraine, particularly in women. The SST2 receptor agonist octreotide has been used with some success in migraine and cluster headache. Authors suggest that the withdrawal of descending tone in SST-containing neurons, might create a false pain signal and hence the headache of migraine. [Review] PMID: 29751998
  2. By unbiased genome-wide DNA methylation profiling and comprehensive stepwise verification and validation studies using in vitro and patient-derived samples, we identified 3 promising methylation markers (GHSR, SST, and ZIC1) associated with a 3q gain for the detection of cervical (pre)cancer PMID: 28119363
  3. Somatostatin pancreatic Delta cells (D cells) locations have also been confirmed in animals and human [review]. PMID: 27977627
  4. Remarkably, the cyclic neuroendocrine peptide somatostatin-14 (SST14) was observed to be the most selectively enriched oligomeric Abeta1-42 binder. PMID: 28650319
  5. This study demonstrated that expression of somatostatin its colocalization with alpha-synuclein in Amygdala in patient with Parkinson disease. PMID: 28859333
  6. These results suggest that the poly-T repeat sequence polymorphism in the promoter of the SST gene is associated with significant variations of blood pressure and could modulate the risk of hypertension, particularly among women. PMID: 26818653
  7. High N-terminal prosomatostatin expression is associated with Cardiovascular Disease and Diabetes. PMID: 27399347
  8. Data show that 6 of 20 primary pancreatic neuroendocrine tumors (PNETs) had positive staining for multiple hormones gastrin, insulin, glucagon, and somatostatin, and positive expression of 1 or more hormones was found in 9 of 12 nonfunctioning PNETs [NF-PNETs]) patients. PMID: 26684862
  9. Patients with chronic pancreatitis were found to have a strong immunohistochemical reaction to somatostatin and changes in the distribution of D cells when compared to healthy patients. PMID: 26589890
  10. Results suggest that DNA methylation may be a proximal mechanism for decreased expression of BDNF, SST, and other BDNF- and GABA-related genes with brain aging and, by extension, for brain disorders in which their expression is decreased PMID: 25881116
  11. In cancerous colonic mucosa promoter hypermethylation-related SST downregulation may contribute to the uncontrolled cell proliferation. PMID: 25723531
  12. Aberrant methylation inactivates somatostatin and SSTR1 in head and neck squamous cell carcinoma. PMID: 25734919
  13. Distribution of peptidergic populations in the human dentate gyrus (somatostatin [SOM-28, SOM-12] and neuropeptide Y [NPY]) during postnatal development. PMID: 24965867
  14. The aim of the study was to provide knowledge on somatostatin and its action on the body, particularly the pancreas - in physiological and pathological conditions--{REVIEW} PMID: 25156131
  15. Somatostatin and insulin together are critical paracrine mediators of glucose-inhibited glucagon secretion and function by lowering cAMP/PKA signaling with increasing glucose. PMID: 25406263
  16. No somatostatin promoter hypermethylation was detected in the Alzheimer neocortex. PMID: 24602981
  17. Hemostatic effects and safety does not differ significantly between somatostatin and octreotide as adjuvants to endoscopic treatment in patients with acute gastroesophageal variceal bleeding. PMID: 24415445
  18. Somatostatin neurons contribute differently to spatial integration. PMID: 23825418
  19. somatostatin limits VEGF release through its interaction with miR-361, indicating that miR-361 participates in the adaptive response of human umbilical vein endothelial cells to hypoxia PMID: 23128854
  20. Somatostatin interneurons-mediated disinhibition represents an important circuit mechanism for cortical information processing. PMID: 23312523
  21. Data suggest that SST-14 inhibits secretion from alpha and beta pancreatic cells by activating GIRK (G protein-coupled inwardly-rectifying potassium channel) and inhibiting exocytosis; these effects are mediated by SST receptor 2 in both cell types. PMID: 22932785
  22. Investigation of the healthy human pylorus shows characteristic distribution of cells that react with antisera to gastrin and somatostatin. PMID: 22532184
  23. PDZ domain-containing 1 (PDZK1) protein regulates phospholipase C-beta3 (PLC-beta3)-specific activation of somatostatin by forming a ternary complex with PLC-beta3 and somatostatin receptors. PMID: 22528496
  24. role played by somatostatin in preventing Abeta accumulation by partially restoring IDE activity PMID: 22509294
  25. Somatostatin neurons hyperpolarized and reduced action potential firing in response to both passive and active whisker sensing, in contrast with all other recorded types of nearby neurons in transgenic mice. PMID: 22366760
  26. Alterations in SST signaling and/or SST-bearing GABA neurons may represent a critical pathophysiological entity that contributes to singulate cortex dysfunction and that matches to the high female vulnerability to develop major depressive disorder. PMID: 21232602
  27. somatostatin inhibits the neuropeptide Y response to hypoglycemia PMID: 21640760
  28. somatostatin suppresses GH activity in peripheral tissues PMID: 21632809
  29. Synchronous firing strength correlates with, and is dependent on, unidirectional or reciprocal GABAergic synapses between electrically coupled fast-spiking and somatostatin-containing inhibitory interneuron subtypes in transgenic mice. PMID: 21368047
  30. SST, presumably via SSTR3/MUPP1, regulates tight junction permeability in cultured keratinocytes PMID: 20629740
  31. Mean value of serum somatostatin at baseline was significantly increased in Parkinson's disease patients compared with the control group (P < 0.01) PMID: 20055772
  32. Data show an increasing tendency in the expressions of GAS and SS in children with chronic gastritis and duodenal ulcer. PMID: 17229384
  33. Increased MCT1 association with CD147 at the apical membrane in response to somatostatin (SST) is p38 MAP kinase dependent and underlies the stimulatory effects of SST on butyrate uptake in human intestinal epithelial cells. PMID: 20501436
  34. somatostatin decreases in Alzheimer's disease and its expression may be linked with Abeta deposition PMID: 19559700
  35. down-regulated KLF4, CHGA, GPX3, SST and LIPF, together with up-regulated SERPINH1, THY1 and INHBA is an 8-gene signature for gastric cancer PMID: 20043075
  36. Our results supported the notion that the C allele of the rs4988514 polymorphism may increase the risk for AD in the Chinese population and possibly have additive effect with the APOE epsilon4 allele. PMID: 19733630
  37. A critical analysis is made of the structure and physiology of SST and its receptors, and the possible role it plays in cell proliferation in animal models and the treatment of human tumors. PMID: 11753230
  38. The somatostatin-28 (S-28) NPAMAP peptide sequence constitutes an accurate alpha-helix nucleation motif allowing for the generation of equal amounts of S-28 and somatostatin-14 from their common precursor in cultured cells. PMID: 11814357
  39. Somatostatin acts as a selective chemoattractant for immature hematopoietic cells PMID: 11823046
  40. Structural motifs in the somatostatin precursor PMID: 11860030
  41. Somatostatin modulates G-CSF-induced but not interleukin-3-induced proliferative responses in myeloid 32D cells via activation of somatostatin receptor subtype 2. PMID: 11920268
  42. present in human colorectal adenocarcinomas and liver metastases PMID: 12174892
  43. somatostatin receptor 2 mRNA was selectively expressed, somatostatin mRNA was not detectable, and cortistatin mRNA was expressed in all samples of monocytes monocyte-derived macrophages, and dendritic cells in basal and lipopolysaccharide-activated state PMID: 12684217
  44. somatostatin has a role in inhibiting ERK 1/2 signaling and the PI3-K pathway via the inhibition of Rac in SHSY5Y cells PMID: 12902325
  45. Fasting but not postprandial hypersomatostatinemia, mainly due to an increase in SS-14, characterizes acromegaly. Excess GH/IGF-I could be a causal factor in somatostatin hypersecretion. PMID: 12952361
  46. Reduced ghrelin, impaired growth hormone(GH) response to GHRH by excess FFA, and increased somatostatin tone contribute to reduced GH secretion in patients with HIV-lipodystrophy. PMID: 14559725
  47. High concentration of somatostatin (SST) in respiratory centers of fetal brainstems correlates with its involvement in the inhibition of intrauterine breathing. PMID: 15266779
  48. SST acts both centrally and peripherally to control the GH-IGF-I axis. PMID: 15286801
  49. certain bioactive peptides such as somatostatin and substance P directly interact with human P-glycoprotein as endogenous substrates for P-glycoprotein-mediated transport PMID: 15358539
  50. human visceral adipose tissue secretes SRIF during inflammation and sepsis PMID: 15472172

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Somatostatin family
Database Links

HGNC: 11329

OMIM: 182450

KEGG: hsa:6750

STRING: 9606.ENSP00000287641

UniGene: Hs.12409

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*