Code | CSB-YP865173HU |
MSDS | |
Size | Pls inquire |
Source | Yeast |
Have Questions? | Leave a Message or Start an on-line Chat |
Code | CSB-EP865173HU-B |
MSDS | |
Size | Pls inquire |
Source | E.coli |
Conjugate | Avi-tag Biotinylated E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag. |
Have Questions? | Leave a Message or Start an on-line Chat |
Code | CSB-BP865173HU |
MSDS | |
Size | Pls inquire |
Source | Baculovirus |
Have Questions? | Leave a Message or Start an on-line Chat |
Code | CSB-MP865173HU |
MSDS | |
Size | Pls inquire |
Source | Mammalian cell |
Have Questions? | Leave a Message or Start an on-line Chat |
There are currently no reviews for this product.
does it contain Fasciclin domain 7 (FAS1 7, 2322 – 2459aa
Please can you provide sequence, pricing, availability and tag information for all available sizes?
“Is that a full length 1-2570 aa protein that you are selling or a partial protein?
If partial protein, does it contain Fasciclin domain 7 (FAS1 7, 2322 – 2459aa) we urgently need?
Is N-terminus that is tagged, is it GST tag?”
EALASDLPNLGPLRTMHGTPISFSCSRTRAGELMVGEDDARIVQRHLPFEGGLAYGIDQLLEPPGLGARCDHFETRPLRLNTCSICGLEPPCPEGSQEQG
STCNGKLLDVLAATANFSTFYGMLLGYANATQRGLDFLDFLDDELTYKTLFVPVNEGFVDNMTLSGPDLELHASNATLLSANASQGKLLPAHSGLSLIISDAGPDNSSWAPVAPGTVVVSRIIVWDIMAFNGIIHALASPLLAP