Name: Recombinant Human Stabilin-1 (STAB1), partial
Brand: CUSABIO
SKU: 865173HU

Product Details

Purity

>85% (SDS-PAGE)

Target Names

STAB1

Uniprot No.

Q9NY15

Alternative Names

CLEVER 1; Common lymphatic endothelial and vascular endothelial receptor 1; EGF-like; Fasciclin; Fasciclin EGF like laminin type EGF like and link domain containing scavenger receptor 1; fasciclin egf-like; FEEL 1; FEEL-1; FELE 1; FEX1; KIAA0246; laminin-type EGF-like and link domain-containing scavenger receptor 1; MS 1 antigen; MS-1 antigen; STAB 1; Stab1; STAB1_HUMAN; Stabilin-1

Species

Homo sapiens (Human)

Protein Length

Partial

Tag Info

Tag type will be determined during the manufacturing process.

The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer before Lyophilization

Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet

Please contact us to get it.

Related Products

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

■ Q&A

does it contain Fasciclin domain 7 (FAS1 7, 2322 – 2459aa

Thanks for your inquiry, we could provide the customs service for the specific express region as you request. According to your request, we could provide the protein with the express region 2319-2462aa, which contain the Fasciclin domain 7.

Please can you provide sequence, pricing, availability and tag information for all available sizes?
“Is that a full length 1-2570 aa protein that you are selling or a partial protein?
If partial protein, does it contain Fasciclin domain 7 (FAS1 7, 2322 – 2459aa) we urgently need?
Is N-terminus that is tagged, is it GST tag?”

Thanks for your inquiry.
Reference: https://www.uniprot.org/uniprot/Q9NY15
Yes, this full length protein has 2570aa, which is too difficult to express the whole full length sequence, what we provide is the partial.
Recombinant Human Stabilin-1(STAB1) ,partial
CSB-EP865173HU >> E.coli
Expression Region: 1804-1903aa; Partial.
Tag information:Tag type will be determined during the manufacturing process.
The expected tag is N-terminal 10xHis-tagged and C-terminal Myc-tagged.
Sequence:

EALASDLPNLGPLRTMHGTPISFSCSRTRAGELMVGEDDARIVQRHLPFEGGLAYGIDQLLEPPGLGARCDHFETRPLRLNTCSICGLEPPCPEGSQEQG

The above region that we provide doesn't include your desired region, since you urgently needs the Fasciclin domain 7 (FAS1 7, 2322–2459aa),
please check the following protein which includes this region.
Recombinant Human Stabilin-1(STAB1) ,partial
CSB-EP865173HU1 >> E.coli
Expression Region: 2319-2462aa; Include the Fasciclin domain 7 (FAS1 7, 2322–2459aa)
Tag information:Tag type will be determined during the manufacturing process.
The expected tag is N-terminal 10xHis-tagged and C-terminal Myc-tagged.
Sequence:

STCNGKLLDVLAATANFSTFYGMLLGYANATQRGLDFLDFLDDELTYKTLFVPVNEGFVDNMTLSGPDLELHASNATLLSANASQGKLLPAHSGLSLIISDAGPDNSSWAPVAPGTVVVSRIIVWDIMAFNGIIHALASPLLAP

If you need the N-terminal GST-Tag, please remark this requirement when placing the order, we can try this tag preferentially, but it's not 100% guaranteed, if we are failed to express this tag, we will communicate with you in advance and provide the protein with other tag that you can accept.

Target Background

Function

Acts as a scavenger receptor for acetylated low density lipoprotein. Binds to both Gram-positive and Gram-negative bacteria and may play a role in defense against bacterial infection. When inhibited in endothelial tube formation assays, there is a marked decrease in cell-cell interactions, suggesting a role in angiogenesis. Involved in the delivery of newly synthesized CHID1/SI-CLP from the biosynthetic compartment to the endosomal/lysosomal system.

Gene References into Functions

Satb1 promotes osteoclastogenesis by recruiting CREB-binding protein to upregulate miR-223 expression in chronic kidney disease-mineral and bone disorder PMID: 29442043
Systemic rAAV-DCN in neuroblastoma-grafted nude mice inhibited stabilin-1. PMID: 28631095
Results suggest stabilin-1 mediated silent clearance of extracellular tumor growth-inhibiting factors as a mechanism of stabilin-1 induced tumor growth. PMID: 27105498
These data define stabilin-1 as a new immunosuppressive molecule and suggest that stabilin-1(high) monocytes may dampen proinflammatory reactions in vivo. PMID: 26608916
The present findings suggest that STAB1 is a new and highly promising candidate gene in this region. The combining of gene expression and GWAS data may provide valuable insights into the biological mechanisms of BD. PMID: 25136889
Genes within recently identified loci associated with waist-hip ratio (WHR) exhibit fat depot-specific mRNA expression, which correlates with obesity-related traits. Adipose tissue (AT) mRNA expression of 6 genes (TBX15/WARS2, STAB1, PIGC, ZNRF3, GRB14 PMID: 23670221
The associations between CLEVER-1 expression on endothelial vessels and macrophage/leukocyte infiltration is suggestive of its regulation by inflammatory conditions in breast cancer, most likely by macrophage-associated cytokines. PMID: 21483103
macrophage stabilin-1/CLEVER-1 can potentially regulate leukocyte migration and scavenging during the development of the placenta and fetus PMID: 21480214
Studies identified a binding site on SPARC for stabilin-1 by a solid-state peptide array coupled with a modified enzyme-linked immunosorbent assay. PMID: 21308731
CLEVER-1/stabilin-1 can support lymphocyte transendothelial migration; it also may provide an organ-specific signal for regulatory T cell recruitment to the inflamed liver and to hepatocellular carcinoma. PMID: 21368224
Studies shoe that understanding stabilin-1 behavior in complex biological systems and would open perspectives for therapeutic targeting of stabilin-1 pathways in chronic inflammation. PMID: 20953554
these results indicate that GULP functions as an adaptor protein for stabilin-1-mediated phagocytosis. PMID: 20599701
role in endocytic clearance and secretion in macrophages; review PMID: 19457577
code for homologous transmembrane proteins featuring seven fasciclin-like adhesion domains, 18-20 epidermal-growth-factor domains, one X-link domain and three to six B-(X(7))-B hyaluronan-binding motifs PMID: 11829752
FEEL-1, a novel scavenger receptor with in vitro bacteria-binding and angiogenesis-modulating activities. PMID: 12077138
This and FEEL-2 are endocytic receptors for advanced glycation end products. PMID: 12473645
CLEVER-1 also known as stabilin-1 or FEEL-1) is a large multifunctional glycoprotein implicated in scavenging, angiogenesis, cell adhesion and angiogenesis PMID: 15297319
role for stabilin-1 as a rapidly recycling scavenger receptor PMID: 15345716
stabilin-1 may function in endocytic and secretory processes of human macrophages. PMID: 15345724
Stabilin-1 internalizes and targets secreted protein acidic and rich in cysteine (SPARC) to an endosomal pathway in stably transfected Chinese hamster ovary cells. PMID: 16670288
Stabilin-1 mediates internalization and endosomal sorting of placental lactogen. PMID: 18292525
Stabilin-1, found on alternatively activated macrophages, is a phagocytic receptor mediating the clearance of apoptotic cells in a phosphatidylserine-dependent manner. PMID: 19726632
The novel GGA-binding site EDDADDD is essential for stabilin-1-mediated intracellular sorting but is not required for endocytosis. PMID: 19752197

Hide All

Subcellular Location

Membrane; Single-pass type I membrane protein.

Tissue Specificity

High levels found in spleen, lymph node, liver and placenta. Also expressed in endothelial cells.

Database Links

HGNC: 18628

OMIM: 608560

KEGG: hsa:23166

STRING: 9606.ENSP00000312946

UniGene: Hs.301989

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：
Please enter the characters shown. Click the image to refresh if unclear.

Code	CSB-YP865173HU
MSDS	MSDS Datasheet
Size	Pls inquire
Source	Yeast
Have Questions?	Leave a Message or Start an on-line Chat

Code	CSB-EP865173HU-B
MSDS	MSDS Datasheet
Size	Pls inquire
Source	E.coli
Conjugate	Avi-tag Biotinylated E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions?	Leave a Message or Start an on-line Chat

Code	CSB-BP865173HU
MSDS	MSDS Datasheet
Size	Pls inquire
Source	Baculovirus
Have Questions?	Leave a Message or Start an on-line Chat

Code	CSB-MP865173HU
MSDS	MSDS Datasheet
Size	Pls inquire
Source	Mammalian cell
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Stabilin-1 (STAB1), partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage