Recombinant Human Stabilin-1 (STAB1), partial

In Stock
Code CSB-EP865173HU
Abbreviation Recombinant Human STAB1 protein, partial
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Signal Transduction
Alternative Names
(Fasciclin, EGF-like, laminin-type EGF-like and link domain-containing scavenger receptor 1)(FEEL-1)(MS-1 antigen)
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
2319-2462aa
Target Protein Sequence
STCNGKLLDVLAATANFSTFYGMLLGYANATQRGLDFLDFLDDELTYKTLFVPVNEGFVDNMTLSGPDLELHASNATLLSANASQGKLLPAHSGLSLIISDAGPDNSSWAPVAPGTVVVSRIIVWDIMAFNGIIHALASPLLAP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
22.7
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Acts as a scavenger receptor for acetylated low density lipoprotein. Binds to both Gram-positive and Gram-negative bacteria and may play a role in defense against bacterial infection. When inhibited in endothelial tube formation assays, there is a marked decrease in cell-cell interactions, suggesting a role in angiogenesis. Involved in the delivery of newly synthesized CHID1/SI-CLP from the biosynthetic compartment to the endosomal/lysosomal system.
Gene References into Functions
  1. Satb1 promotes osteoclastogenesis by recruiting CREB-binding protein to upregulate miR-223 expression in chronic kidney disease-mineral and bone disorder PMID: 29442043
  2. Systemic rAAV-DCN in neuroblastoma-grafted nude mice inhibited stabilin-1. PMID: 28631095
  3. Results suggest stabilin-1 mediated silent clearance of extracellular tumor growth-inhibiting factors as a mechanism of stabilin-1 induced tumor growth. PMID: 27105498
  4. These data define stabilin-1 as a new immunosuppressive molecule and suggest that stabilin-1(high) monocytes may dampen proinflammatory reactions in vivo. PMID: 26608916
  5. The present findings suggest that STAB1 is a new and highly promising candidate gene in this region. The combining of gene expression and GWAS data may provide valuable insights into the biological mechanisms of BD. PMID: 25136889
  6. Genes within recently identified loci associated with waist-hip ratio (WHR) exhibit fat depot-specific mRNA expression, which correlates with obesity-related traits. Adipose tissue (AT) mRNA expression of 6 genes (TBX15/WARS2, STAB1, PIGC, ZNRF3, GRB14 PMID: 23670221
  7. The associations between CLEVER-1 expression on endothelial vessels and macrophage/leukocyte infiltration is suggestive of its regulation by inflammatory conditions in breast cancer, most likely by macrophage-associated cytokines. PMID: 21483103
  8. macrophage stabilin-1/CLEVER-1 can potentially regulate leukocyte migration and scavenging during the development of the placenta and fetus PMID: 21480214
  9. Studies identified a binding site on SPARC for stabilin-1 by a solid-state peptide array coupled with a modified enzyme-linked immunosorbent assay. PMID: 21308731
  10. CLEVER-1/stabilin-1 can support lymphocyte transendothelial migration; it also may provide an organ-specific signal for regulatory T cell recruitment to the inflamed liver and to hepatocellular carcinoma. PMID: 21368224
  11. Studies shoe that understanding stabilin-1 behavior in complex biological systems and would open perspectives for therapeutic targeting of stabilin-1 pathways in chronic inflammation. PMID: 20953554
  12. these results indicate that GULP functions as an adaptor protein for stabilin-1-mediated phagocytosis. PMID: 20599701
  13. role in endocytic clearance and secretion in macrophages; review PMID: 19457577
  14. code for homologous transmembrane proteins featuring seven fasciclin-like adhesion domains, 18-20 epidermal-growth-factor domains, one X-link domain and three to six B-(X(7))-B hyaluronan-binding motifs PMID: 11829752
  15. FEEL-1, a novel scavenger receptor with in vitro bacteria-binding and angiogenesis-modulating activities. PMID: 12077138
  16. This and FEEL-2 are endocytic receptors for advanced glycation end products. PMID: 12473645
  17. CLEVER-1 also known as stabilin-1 or FEEL-1) is a large multifunctional glycoprotein implicated in scavenging, angiogenesis, cell adhesion and angiogenesis PMID: 15297319
  18. role for stabilin-1 as a rapidly recycling scavenger receptor PMID: 15345716
  19. stabilin-1 may function in endocytic and secretory processes of human macrophages. PMID: 15345724
  20. Stabilin-1 internalizes and targets secreted protein acidic and rich in cysteine (SPARC) to an endosomal pathway in stably transfected Chinese hamster ovary cells. PMID: 16670288
  21. Stabilin-1 mediates internalization and endosomal sorting of placental lactogen. PMID: 18292525
  22. Stabilin-1, found on alternatively activated macrophages, is a phagocytic receptor mediating the clearance of apoptotic cells in a phosphatidylserine-dependent manner. PMID: 19726632
  23. The novel GGA-binding site EDDADDD is essential for stabilin-1-mediated intracellular sorting but is not required for endocytosis. PMID: 19752197

Show More

Hide All

Subcellular Location
Membrane; Single-pass type I membrane protein.
Tissue Specificity
High levels found in spleen, lymph node, liver and placenta. Also expressed in endothelial cells.
Database Links

HGNC: 18628

OMIM: 608560

KEGG: hsa:23166

STRING: 9606.ENSP00000312946

UniGene: Hs.301989

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*