Recombinant Human Suppressor of cytokine signaling 2(SOCS2)

Code CSB-EP022389HU
Product Type Recombinant Protein
Size US$2466
Uniprot No. O14508
Relevance SOCS family proteins form part of a classical negative feedback system that regulates cytokine signal transduction. SOCS2 appears to be a negative regulator in the growth hormone/IGF1 signaling pathway. Probable substrate recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Cytokine-inducible SH2 protein 2
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MTLRCLEPSGNGGEGTRSQWGTAGSAEEPSPQAARLAKALRELGQTGWYWGSMTVNEAKEKLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSIICVKSKLKQFDSVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPSLQHLCRLTINKCTGAIWGLPLPTRLKDYLEEYKFQV
Research Area Immunology
Source E.coli
Gene Names SOCS2
Protein Names Recommended name: Suppressor of cytokine signaling 2 Short name= SOCS-2 Alternative name(s): Cytokine-inducible SH2 protein 2 Short name= CIS-2 STAT-induced STAT inhibitor 2 Short name= SSI-2
Expression Region 1-198aa
Tag Info N-terminal GST-tagged
Mol. Weight 49.2kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function SOCS family proteins form part of a classical negative feedback system that regulates cytokine signal transduction. SOCS2 appears to be a negative regulator in the growth hormone/IGF1 signaling pathway. Probable substrate recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.
Tissue Specificity High expression in heart, placenta, lung, kidney and prostate.
Database Links

HGNC: 19382

OMIM: 605117

KEGG: hsa:8835

STRING: 9606.ENSP00000339428

UniGene: Hs.485572

Pathway Jak-STAT signaling pathway
Insulin signaling pathway

Related Products

SOCS2 Antibodies

SOCS2 Antibodies for Homo sapiens (Human)

SOCS2 Antibodies for Human

SOCS2 Proteins

SOCS2 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.