Recombinant Human Suppressor of cytokine signaling 2 (SOCS2)

Code CSB-EP022389HU
Abbreviation Recombinant Human SOCS2 protein
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Immunology
Alternative Names
CIS 2; CIS-2; CIS2; Cish 2; Cish2; Cytokine inducible SH2 protein 2; Cytokine-inducible SH2 protein 2; SOCS 2; SOCS-2; Socs2; SOCS2_HUMAN; SSI 2; SSI-2; SSI2; STAT induced STAT inhibitor 2; STAT-induced STAT inhibitor 2; STATI 2; STATI2; Suppressor of cytokine signaling 2
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-198aa
Target Protein Sequence
MTLRCLEPSGNGGEGTRSQWGTAGSAEEPSPQAARLAKALRELGQTGWYWGSMTVNEAKEKLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSIICVKSKLKQFDSVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPSLQHLCRLTINKCTGAIWGLPLPTRLKDYLEEYKFQV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
49.2kDa
Protein Length
Full Length
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
SOCS family proteins form part of a classical negative feedback system that regulates cytokine signal transduction. SOCS2 appears to be a negative regulator in the growth hormone/IGF1 signaling pathway. Probable substrate recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.
Gene References into Functions
  1. SOCS2 impairs IFN/JAK/STAT signaling through reducing the stability of tyrosine kinase 2 (TYK2), downregulating the expression of type I and III IFN receptors, attenuating the phosphorylation and nucleus translocation of STAT1. PMID: 28496097
  2. High SOCS2 expression is associated with higher grade breast cancer. PMID: 30453988
  3. Study provides evidence for an inhibitory role of SOCS2 in TNFalpha induced NF-kappa B activation, identifies NDR1 as a novel substrate of SOCS2, and demonstrates that SOCS2 and TNFalpha induced NF-kappa B signaling are linked through NDR1. PMID: 28216640
  4. Overexpression of miR-196b suppresses SOCS2 in human laryngeal squamous cell carcinoma resulting in tumor progression and poor prognosis. PMID: 29753737
  5. Methyltransferase-like 3 represses SOCS2 expression in hepatocellular carcinoma through an m6A-YTHDF2-dependent mechanism. Our findings suggest an important mechanism of epigenetic alteration in liver carcinogenesis PMID: 29171881
  6. Study in lung cancer BEAS-2B cells shows that SOCS2 binding to the growth hormone receptor (GHR) is impaired by a GHR threonine substitution at Pro 495. This results in decreased internalisation and degradation of the receptor. PMID: 28967904
  7. Despite of the key role of SOCS2 in the regulation of GH receptor signaling, study did not find any significant association between SOCS2 polymorphisms and acromegaly. PMID: 27900634
  8. The induction of a tolerogenic phenotype in DCs by NPs was mediated by the AhR-dependent induction of Socs2, which resulted in inhibition of nuclear factor kappaB activation and proinflammatory cytokine production (properties of tolerogenic DCs). PMID: 27330188
  9. Long-term palmitate treatment up-regulates SOCS2 and reduces PI3K activity, thereby impairing glucose stimulated insulin secretion. PMID: 27566229
  10. Targeting of SOCS2 by miR-194 resulted in derepression of the oncogenic kinases FLT3 and JAK2, leading to enhanced ERK and STAT3 signaling. PMID: 28011622
  11. Single-cell RNA sequencing reveals enrichment of homeostatic modules in monocytes and dendritic cells from human metastatic melanoma. Suppressor-of-cytokine-2 (SOCS2) protein, a conserved program transcript, is expressed by mononuclear phagocytes infiltrating primary melanoma and is induced by IFNgamma. PMID: 28666115
  12. this study shows that IL-7 induces the expression of SOCS2 through the JAK/STAT-5 pathway and that SOCS2 interacts with CD127 in early endosomes and direct the receptor complex to the proteasome for degradation PMID: 27423467
  13. Overexpression of SOCS2 inverted these phenotypes generated by hsv2-miR-H9-5p, indicating the potential roles of SOCS2 in Hsv2-miR-H9-5p-driven metastasis in lung cancers. The results highlighted that Hsv2-miR-H9-5p regulated and contributed to bone metastasis of lung cancers. We proposed that Hsv2-miR-H9-5p could be used as a potential target in lung cancer therapy PMID: 28468588
  14. Overexpression of SOCS-2 is associated with hepatocellular carcinoma. PMID: 27465557
  15. focus on SOCS2 and review its biological function as well as its implication in pathological processes PMID: 26709655
  16. SOCS2 may improve outcome of TBI in mice by regulating aspects of the neuroinflammatory response PMID: 27071013
  17. This study showed that there was significantly increased levels of SOCS-2 mRNA in elderly and Alzheimer's disease brains. PMID: 25286386
  18. crystals of SOCS2 in complex with its adaptor proteins, Elongin C and Elongin B, underwent a change in crystallographic parameters when treated with dimethyl sulfoxide during soaking experiments. PMID: 26121586
  19. miR-101 functions as a growth-suppressive miRNA in H. pylori related GC, and that its suppressive effects are mediated mainly by repressing SOCS2 expression. PMID: 25561270
  20. our study indicates that high SOCS2 expression is associated with poor survival in pediatric AML. PMID: 24559289
  21. This study shows that over-expression of SOCS2 reduces the psychostimulant effects of amphetamine, enhances PPI, and alters mesolimbic dopaminergic activity. PMID: 25283341
  22. The SOCS2 polymorphism (rs3782415) has an influence on the adult height of children with Turner syndrome and growth hormone deficiency after long-term therapy. PMID: 24905066
  23. SOCS2 correlates with malignancy and exerts growth-promoting effects in prostate cancer. PMID: 24280133
  24. Stage-independent downregulation of SOCS2 and SOCS6 correlate with disease-free survival in colorectal cancer. PMID: 25025962
  25. SOCS2 mediates the cross talk between androgen and growth hormone signaling in prostate cancer. PMID: 24031028
  26. SOCS2 associates with activated FLT3 through phosphotyrosine residues 589 and 919, and co-localizes with FLT3 in the cell membrane. PMID: 23548639
  27. Estradiol can amplify GH intracellular signaling in human osteoblasts with an essential role played by the reduction of the SOCS2 mediated feedback loop. PMID: 23567159
  28. SOCS2 and SOCS6 expression are remarkably reduced in hepatocellular carcinoma and correlate with aggressive tumor progression and poor prognosis PMID: 23475171
  29. Simultaneous stimulation of monocyte-derived DCs resulted in highly increased production of IL-1beta, IL-23 and SOCS2. PMID: 22795647
  30. Data demonstrated that suppressor of cytokine signaling 2 (SOCS2) protein level was distinctively increased by saponin, which in turn resulted in inhibition of HCV replication. PMID: 22745742
  31. High SOCS2 is associated with idiopathic short stature. PMID: 22768656
  32. LPS regulates SOCS2 transcription in a type I interferon dependent autocrine-paracrine loop. PMID: 22291912
  33. We propose a model in which SOCS2 acts as a negative regulator of TLR-induced dendritic cell activation PMID: 21844389
  34. Data show that knockdown of SOCS2 resulted in the accumulation of p-Pyk2(Tyr402) and blocked NK cell effector functions. PMID: 20543098
  35. Probiotic administration increased expression of SOCS-2 and SOCS-3 in Helicobacter pylori infection to limit inflammatory signaling. PMID: 20136974
  36. SOCS2 is required for appropriate TLR4 signaling in maturating human DCs via both the MyD88-dependent and -independent signaling pathway PMID: 19779605
  37. SOCS-2 is overexpressed in advanced stages of chronic myeloid leukemia. It may be a component of a negative feedback mechanism that is functioning inadequately, induced by Bcr-Abl but unable to reverse its growth-promoting effects. PMID: 11861294
  38. SOCS2 mediates the suppression of JAK2 phosphorylation by estrogen, which inhibits growth hormone signaling PMID: 12552091
  39. Association of single-nucleotide polymorphisms in the SOCS2 gene with type 2 diabetes in the Japanese was studied. PMID: 16406727
  40. Results describe the 1.9-A crystal structure of the ternary complex of SOCS2 with elongin C and elongin B. PMID: 16675548
  41. SOCS2 only interacts with the Y1077 motif, but with higher binding affinity and can interfere with CIS and STAT5a prey recruitment at this site. PMID: 16684815
  42. Using RT-PCR, we demonstrated for the first time that neutrophils express mRNA for SOCS-2. PMID: 17264307
  43. A defect in expression of SOCS-2 and SOCS-3 genes may be crucial for the IGF-I hypersensitivity and progressive increase in erythroid cell population size characteristic of Polycythemia vera. PMID: 17325857
  44. Favorable prognostic value of high SOCS2 expression in primary mammary carcinomas. PMID: 17651480
  45. analysis of STAT5, CIS, and SOCS2 interactions with the growth hormone receptor PMID: 17666591
  46. SOCS2 epigenetic downregulation might be an important second step in the genesis of cytokine-independent myeloproliferative disorder clones PMID: 18769447
  47. Acromegalic patients with active disease and hyperplastic polyps had higher levels of SOCS2 transcripts. PMID: 18844680
  48. role of SOCS-2 in mediating HIV-1-induced immune evasion and dysregulation of IFNgamma signaling in primary human monocytes PMID: 19279332
  49. SOCS2 expression is regulated by STAT5. PMID: 17008382

Show More

Hide All

Tissue Specificity
High expression in heart, placenta, lung, kidney and prostate. Predominantly expressed in pulmonary epithelia cells, specifically type II pneumocytes.
Database Links

HGNC: 19382

OMIM: 605117

KEGG: hsa:8835

STRING: 9606.ENSP00000339428

UniGene: Hs.485572

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*